Germany
Japan
United Kingdom
China
PLA2G3 (Myc-DDK-tagged)-Human phospholipase A2, group III (PLA2G3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF particles, PLA2G3 (Myc-DDK tagged) - Human phospholipase A2, group III (PLA2G3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PLA2G3 (mGFP-tagged) - Human phospholipase A2, group III (PLA2G3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PLA2G3 (GFP-tagged) - Human phospholipase A2, group III (PLA2G3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human phospholipase A2, group III (PLA2G3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PLA2G3 (Myc-DDK tagged) - Human phospholipase A2, group III (PLA2G3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, PLA2G3 (mGFP-tagged) - Human phospholipase A2, group III (PLA2G3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20) |
Lenti ORF clone of Human phospholipase A2, group III (PLA2G3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
PLA2G3 (untagged)-Human phospholipase A2, group III (PLA2G3)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Purified recombinant protein of Human phospholipase A2, group III (PLA2G3), full length, with N-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Lenti ORF clone of Human phospholipase A2, group III (PLA2G3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human phospholipase A2, group III (PLA2G3), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PLA2G3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Immunogen | PLA2G3 antibody was raised against synthetic 16 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Rat, Dog, Hamster (94%); Elephant, Panda, Rabbit (88%); Bovine, Horse, Pig (81%). |
PLA2G3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Gorilla, Human, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%). |
Rabbit Polyclonal Anti-PLA2G3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G3 antibody is: synthetic peptide directed towards the C-terminal region of Human PLA2G3. Synthetic peptide located within the following region: QRRHQLQDKGTDERQPWPSEPLRGPMSFYNQCLQLTQAARRPDRQQKSWS |
Carrier-free (BSA/glycerol-free) PLA2G3 mouse monoclonal antibody,clone OTI1F4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PLA2G3 mouse monoclonal antibody,clone OTI4F2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PLA2G3 mouse monoclonal antibody,clone OTI8G8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PLA2G3 mouse monoclonal antibody,clone OTI1F4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PLA2G3 mouse monoclonal antibody,clone OTI1F4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
PLA2G3 mouse monoclonal antibody,clone OTI1F4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
PLA2G3 mouse monoclonal antibody,clone OTI1F4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PLA2G3 mouse monoclonal antibody,clone OTI4F2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PLA2G3 mouse monoclonal antibody,clone OTI4F2, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
PLA2G3 mouse monoclonal antibody,clone OTI4F2, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
PLA2G3 mouse monoclonal antibody,clone OTI4F2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PLA2G3 mouse monoclonal antibody,clone OTI8G8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PLA2G3 mouse monoclonal antibody,clone OTI8G8, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
PLA2G3 mouse monoclonal antibody,clone OTI8G8, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
PLA2G3 mouse monoclonal antibody,clone OTI8G8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of PLA2G3 (NM_015715) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PLA2G3 (NM_015715) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PLA2G3 (NM_015715) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PLA2G3
Pathways
- Fc epsilon RI signaling pathway