Germany
Japan
United Kingdom
China
ARPC3 (Myc-DDK-tagged)-Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 820.00
4 Weeks
Lenti ORF particles, ARPC3 (Myc-DDK tagged) - Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, ARPC3 (mGFP-tagged) - Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
ARPC3 (myc-DDK-tagged) - Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ARPC3 (GFP-tagged) - Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, ARPC3 (Myc-DDK tagged) - Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, ARPC3 (mGFP-tagged) - Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ARPC3 (myc-DDK-tagged) - Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
ARPC3 (untagged)-Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ARPC3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit polyclonal antibody to p21-ARC (actin related protein 2/3 complex, subunit 3, 21kDa)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Pig, Rhesus Monkey, Bovine) |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 178 of p21-ARC (Uniprot ID#O15145) |
p21 ARC (ARPC3) (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human ARPC3 |
Transient overexpression lysate of actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Goat Polyclonal Antibody against ARPC3
| Applications | WB |
| Reactivities | Test: Human, Mouse. Expected from seq similarity: Human, Mouse, Rat, Dog, Cow |
| Immunogen | Peptide with sequence C-RQFMNKSLSGPGQ, from the C Terminus of the protein sequence according to NP_005710. |
Rabbit Polyclonal Anti-ARPC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-ARPC3 antibody: synthetic peptide directed towards the N terminal of human ARPC3. Synthetic peptide located within the following region: MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFK |
Rabbit Polyclonal Anti-ARPC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-ARPC3 antibody: synthetic peptide directed towards the middle region of human ARPC3. Synthetic peptide located within the following region: ITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP |
ARPC3 / ARC21 (1-178, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
ARPC3 / ARC21 (1-178, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
ARPC3 MS Standard C13 and N15-labeled recombinant protein (NP_005710)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
ARPC3 (GFP-tagged) - Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ARPC3 (GFP-tagged) - Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ARPC3 (untagged) - Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ARPC3 (untagged) - Human actin related protein 2/3 complex, subunit 3, 21kDa (ARPC3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of ARPC3 (NM_005719) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ARPC3 (NM_001287222) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ARPC3 (NM_001278556) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ARPC3 (NM_005719) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ARPC3 (NM_005719) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ARPC3 (NM_001287222) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ARPC3 (NM_001278556) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ARPC3 (NM_001278556) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ARPC3
Pathways
- Fc gamma R-mediated phagocytosis