CRKL (Myc-DDK-tagged)-Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CRKL (Myc-DDK-tagged)-Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CRKL (untagged)-Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CRKL (GFP-tagged) - Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Lenti ORF particles, CRKL (Myc-DDK tagged) - Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CRKL (mGFP-tagged) - Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CRKL (Myc-DDK tagged) - Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CRKL (mGFP-tagged) - Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CRKL rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against CRKL
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KIFDPQNPDENE, from the C Terminus of the protein sequence according to NP_005198. |
Rabbit monoclonal antibody against Phospho CrkL (pY207)(EP270Y) (phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Modifications | Phospho-specific |
CRKL HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CRKL pTyr207 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
CRKL rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal anti-CRKL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CRKL antibody is: synthetic peptide directed towards the middle region of Human CRKL. Synthetic peptide located within the following region: RSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPS |
CRKL (1-303, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
CRKL (1-303, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Transient overexpression lysate of v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
CRKL MS Standard C13 and N15-labeled recombinant protein (NP_005198)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-CRKL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CRKL |
Transient overexpression of CRKL (NM_005207) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CRKL (NM_005207) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CRKL (NM_005207) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack