Products

View as table Download

CRKL (Myc-DDK-tagged)-Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

CRKL (untagged)-Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

CRKL (GFP-tagged) - Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Recombinant protein of human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL)

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, CRKL (Myc-DDK tagged) - Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, CRKL (mGFP-tagged) - Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF clone of Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CRKL (Myc-DDK tagged) - Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CRKL (mGFP-tagged) - Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

CRKL rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Goat Polyclonal Antibody against CRKL

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-KIFDPQNPDENE, from the C Terminus of the protein sequence according to NP_005198.

Rabbit monoclonal antibody against Phospho CrkL (pY207)(EP270Y) (phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Modifications Phospho-specific

CRKL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

CRKL pTyr207 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

CRKL rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

Rabbit Polyclonal anti-CRKL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRKL antibody is: synthetic peptide directed towards the middle region of Human CRKL. Synthetic peptide located within the following region: RSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPS

CRKL (1-303, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

CRKL (1-303, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

CRKL MS Standard C13 and N15-labeled recombinant protein (NP_005198)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-CRKL Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CRKL

USD 1,070.00

4 Weeks

Transient overexpression of CRKL (NM_005207) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of CRKL (NM_005207) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of CRKL (NM_005207) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack