PDGFC (Myc-DDK-tagged)-Human platelet derived growth factor C (PDGFC), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDGFC (Myc-DDK-tagged)-Human platelet derived growth factor C (PDGFC), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PDGFC (Myc-DDK tagged) - Human platelet derived growth factor C (PDGFC), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PDGFC (mGFP-tagged) - Human platelet derived growth factor C (PDGFC), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PDGFC (GFP-tagged) - Human platelet derived growth factor C (PDGFC), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human platelet derived growth factor C (PDGFC), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PDGFC (Myc-DDK tagged) - Human platelet derived growth factor C (PDGFC), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human platelet derived growth factor C (PDGFC), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PDGFC (mGFP-tagged) - Human platelet derived growth factor C (PDGFC), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human platelet derived growth factor C (PDGFC), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
PDGFC (untagged)-Human platelet derived growth factor C (PDGFC), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Purified recombinant protein of Human platelet derived growth factor C (PDGFC), transcript variant 1.
Tag | Tag Free |
Expression Host | E. coli |
Lenti ORF clone of Human platelet derived growth factor C (PDGFC), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PDGFC HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit anti-PDGFC polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | peptide coupled to KLH |
Rabbit anti-PDGFC polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Partial recombaint protein |
Rabbit Polyclonal Anti-PDGFC Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Pdgfc antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pdgfc. Synthetic peptide located within the following region: MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVV |
Rabbit Polyclonal Anti-PDGFC Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDGFC antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFC. Synthetic peptide located within the following region: CTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPS |
Transient overexpression lysate of platelet derived growth factor C (PDGFC)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-PDGFC Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PDGFC |
Transient overexpression of PDGFC (NM_016205) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDGFC (NM_016205) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PDGFC (NM_016205) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack