MTMR7 (Myc-DDK-tagged)-Human myotubularin related protein 7 (MTMR7)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MTMR7 (Myc-DDK-tagged)-Human myotubularin related protein 7 (MTMR7)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, MTMR7 (Myc-DDK tagged) - Human myotubularin related protein 7 (MTMR7), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, MTMR7 (mGFP-tagged) - Human myotubularin related protein 7 (MTMR7), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
MTMR7 (GFP-tagged) - Human myotubularin related protein 7 (MTMR7)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human myotubularin related protein 7 (MTMR7), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MTMR7 (Myc-DDK tagged) - Human myotubularin related protein 7 (MTMR7), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human myotubularin related protein 7 (MTMR7), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MTMR7 (mGFP-tagged) - Human myotubularin related protein 7 (MTMR7), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human myotubularin related protein 7 (MTMR7), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human myotubularin related protein 7 (MTMR7), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
MTMR7 (untagged)-Human myotubularin related protein 7 (MTMR7)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-MTMR7 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MTMR7 Antibody is: synthetic peptide directed towards the C-terminal region of Human MTMR7. Synthetic peptide located within the following region: NLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFL |
MTMR7 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of myotubularin related protein 7 (MTMR7)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
MTMR7 MS Standard C13 and N15-labeled recombinant protein (NP_004677)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-MTMR7 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MTMR7 |
Transient overexpression of MTMR7 (NM_004686) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MTMR7 (NM_004686) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MTMR7 (NM_004686) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack