Products

cDNA Clones (31)
RNAi (11)
Proteins (7)
Gene Expression (6)
Antibodies (4)
Jump to Filters
View as table Download
MTMR7 (NM_004686) Human Tagged ORF Clone
RC222373

USD 480.00

In Stock

MTMR7 (Myc-DDK-tagged)-Human myotubularin related protein 7 (MTMR7)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
MTMR7 (NM_004686) Human Tagged ORF Clone Lentiviral Particle
RC222373L1V

USD 880.00

3 Weeks

Lenti ORF particles, MTMR7 (Myc-DDK tagged) - Human myotubularin related protein 7 (MTMR7), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
MTMR7 (NM_004686) Human Tagged ORF Clone Lentiviral Particle
RC222373L2V

USD 880.00

6 Weeks

Lenti ORF particles, MTMR7 (mGFP-tagged) - Human myotubularin related protein 7 (MTMR7), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Mtmr7 (BC032254) Mouse Tagged ORF Clone
MR207467

USD 280.00

In Stock

Mtmr7 (Myc-DDK-tagged) - Mouse myotubularin related protein 7 (cDNA clone MGC:40839 IMAGE:5368816)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
MTMR7 (NM_004686) Human Tagged ORF Clone
RG222373

USD 530.00

In Stock

MTMR7 (GFP-tagged) - Human myotubularin related protein 7 (MTMR7)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MTMR7 Human Gene Knockout Kit (CRISPR)
KN422373

USD 1,290.00

2 Weeks

MTMR7 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN422373 is the updated version of KN222373.
Mtmr7 Mouse Gene Knockout Kit (CRISPR)
KN510498

USD 1,290.00

2 Weeks

Mtmr7 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN510498 is the updated version of KN310498.
Mtmr7 (BC032254) Mouse Tagged ORF Clone
MG207467

USD 310.00

3 Weeks

Mtmr7 (GFP-tagged) - Mouse myotubularin related protein 7 (cDNA clone MGC:40839 IMAGE:5368816)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Mtmr7 (NM_001040699) Mouse Tagged ORF Clone
MG215835

USD 760.00

3 Weeks

Mtmr7 (GFP-tagged) - Mouse myotubularin related protein 7 (Mtmr7), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Mtmr7 (BC032254) Mouse Tagged ORF Clone
MR207467L3

USD 480.00

3 Weeks

Lenti ORF clone of Mtmr7 (Myc-DDK-tagged) - Mouse myotubularin related protein 7 (cDNA clone MGC:40839 IMAGE:5368816)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Mtmr7 (BC032254) Mouse Tagged ORF Clone Lentiviral Particle
MR207467L3V

USD 680.00

6 Weeks

Lenti ORF particles, Mtmr7 (Myc-DDK-tagged) - Mouse myotubularin related protein 7 (cDNA clone MGC:40839 IMAGE:5368816), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Mtmr7 (BC032254) Mouse Tagged ORF Clone
MR207467L4

USD 480.00

3 Weeks

Lenti ORF clone of Mtmr7 (mGFP-tagged) - Mouse myotubularin related protein 7 (cDNA clone MGC:40839 IMAGE:5368816)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Mtmr7 (BC032254) Mouse Tagged ORF Clone Lentiviral Particle
MR207467L4V

USD 680.00

6 Weeks

Lenti ORF particles, Mtmr7 (GFP-tagged) - Mouse myotubularin related protein 7 (cDNA clone MGC:40839 IMAGE:5368816), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Mtmr7 (NM_001040699) Mouse Tagged ORF Clone
MR215835

USD 690.00

4 Weeks

Mtmr7 (Myc-DDK-tagged) - Mouse myotubularin related protein 7 (Mtmr7)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Mtmr7 (NM_001040699) Mouse Tagged ORF Clone
MR215835L3

USD 890.00

8 Weeks

Lenti ORF clone of Mtmr7 (Myc-DDK-tagged) - Mouse myotubularin related protein 7 (Mtmr7)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Mtmr7 (NM_001040699) Mouse Tagged ORF Clone
MR215835L4

USD 890.00

8 Weeks

Lenti ORF clone of Mtmr7 (mGFP-tagged) - Mouse myotubularin related protein 7 (Mtmr7)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MTMR7 (NM_004686) Human Tagged ORF Clone
RC222373L3

USD 680.00

3 Weeks

Lenti ORF clone of Human myotubularin related protein 7 (MTMR7), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MTMR7 (NM_004686) Human Tagged ORF Clone Lentiviral Particle
RC222373L3V

USD 880.00

5 Weeks

Lenti ORF particles, MTMR7 (Myc-DDK tagged) - Human myotubularin related protein 7 (MTMR7), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MTMR7 (NM_004686) Human Tagged ORF Clone
RC222373L4

USD 680.00

3 Weeks

Lenti ORF clone of Human myotubularin related protein 7 (MTMR7), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MTMR7 (NM_004686) Human Tagged ORF Clone Lentiviral Particle
RC222373L4V

USD 880.00

7 Weeks

Lenti ORF particles, MTMR7 (mGFP-tagged) - Human myotubularin related protein 7 (MTMR7), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Mtmr7 (NM_001107312) Rat Tagged ORF Clone
RR211487

USD 420.00

4 Weeks

Mtmr7 (Myc-DDK-tagged ORF) - Rat myotubularin related protein 7 (Mtmr7), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Mtmr7 (NM_001107312) Rat Tagged ORF Clone
RR211487L3

USD 640.00

8 Weeks

Lenti ORF clone of Mtmr7 (Myc-DDK-tagged ORF) - Rat myotubularin related protein 7 (Mtmr7), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Mtmr7 (NM_001107312) Rat Tagged ORF Clone
RR211487L4

USD 700.00

8 Weeks

Lenti ORF clone of Mtmr7 (mGFP-tagged ORF) - Rat myotubularin related protein 7 (Mtmr7), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Mtmr7 (NM_001107312) Rat Tagged ORF Clone Lentiviral Particle
RR211487L4V

USD 960.00

12 Weeks

Lenti ORF particles, Mtmr7 (GFP-tagged ORF) - Rat myotubularin related protein 7 (Mtmr7), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MTMR7 (NM_004686) Human Tagged ORF Clone
RC222373L1

USD 840.00

In Stock

Lenti ORF clone of Human myotubularin related protein 7 (MTMR7), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
MTMR7 (NM_004686) Human Tagged ORF Clone
RC222373L2

USD 680.00

3 Weeks

Lenti ORF clone of Human myotubularin related protein 7 (MTMR7), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
MTMR7 (NM_004686) Human Untagged Clone
SC128036

USD 760.00

In Stock

MTMR7 (untagged)-Human myotubularin related protein 7 (MTMR7)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
MTMR7 Rabbit Polyclonal Antibody
TA332091

USD 375.00

5 Days

Rabbit Polyclonal Anti-MTMR7 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MTMR7 Antibody is: synthetic peptide directed towards the C-terminal region of Human MTMR7. Synthetic peptide located within the following region: NLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFL
Human MTMR7 activation kit by CRISPRa
GA106064

USD 1,290.00

2 Weeks

MTMR7 CRISPRa kit - CRISPR gene activation of human myotubularin related protein 7

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Mtmr7 activation kit by CRISPRa
GA205693

USD 1,290.00

2 Weeks

Mtmr7 CRISPRa kit - CRISPR gene activation of mouse myotubularin related protein 7

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
MTMR7 Human qPCR Primer Pair (NM_004686)
HP207961

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene MTMR7

MTMR7 (NM_004686) Human Over-expression Lysate
LC417811

USD 187.00

2 Weeks

MTMR7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MTMR7 (NM_004686) Human Over-expression Lysate
LY417811

USD 605.00

5 Days

Transient overexpression lysate of myotubularin related protein 7 (MTMR7)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Mtmr7 (BC032254) Mouse Untagged Clone
MC218317

USD 730.00

3 Weeks

Mtmr7 (untagged) - Mouse myotubularin related protein 7 (cDNA clone MGC:40839 IMAGE:5368816), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Mtmr7 (NM_001040699) Mouse Untagged Clone
MC220175

USD 890.00

3 Weeks

Mtmr7 (untagged) - Mouse myotubularin related protein 7 (Mtmr7), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Mtmr7 Mouse qPCR Primer Pair (NM_001040699)
MP208593

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Mtmr7

MTMR7 (NM_004686) Human Mass Spec Standard
PH322373

USD 2,055.00

3 Weeks

MTMR7 MS Standard C13 and N15-labeled recombinant protein (NP_004677)

Tag C-Myc/DDK
Expression Host HEK293
Mtmr7 (NM_001107312) Rat Untagged Clone
RN211487

USD 420.00

4 Weeks

Mtmr7 (untagged ORF) - Rat myotubularin related protein 7 (Mtmr7), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
MTMR7 Human siRNA Oligo Duplex (Locus ID 9108)
SR306018

USD 430.00

2 Weeks

MTMR7 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Mtmr7 Mouse siRNA Oligo Duplex (Locus ID 54384)
SR415153

USD 430.00

2 Weeks

Mtmr7 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

MTMR7 Rabbit Polyclonal Antibody
TA349576

USD 345.00

In Stock

Rabbit Polyclonal Anti-MTMR7 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MTMR7
MTMR7 Rabbit Polyclonal Antibody
TA358988

USD 360.00

5 Days

MTMR7 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human MTMR7
MTMR7 Rabbit Polyclonal Antibody
TA361702

USD 360.00

5 Days

MTMR7 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of Human MTMR7
MTMR7 (NM_004686) ICC Control Block
TB422373

USD 1,130.00

4 Weeks

Transient overexpression of MTMR7 (NM_004686) in HEK293T cells paraffin embedded controls for ICC/IHC staining

MTMR7 Human shRNA Plasmid Kit (Locus ID 9108)
TL311351

USD 815.00

2 Weeks

MTMR7 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
MTMR7 Human shRNA Lentiviral Particle (Locus ID 9108)
TL311351V

USD 1,395.00

5 Weeks

MTMR7 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
Mtmr7 Mouse shRNA Plasmid (Locus ID 54384)
TL503022

USD 815.00

2 Weeks

Mtmr7 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti