Germany
Japan
United Kingdom
China
GNAQ (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, GNAQ (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GNAQ (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GNAQ (GFP-tagged) - Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GNAQ (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, GNAQ (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GNAQ (untagged)-Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-GNAQ Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAQ antibody: synthetic peptide directed towards the N terminal of human GNAQ. Synthetic peptide located within the following region: DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK |
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
GNAQ HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of guanine nucleotide binding protein (G protein), q polypeptide (GNAQ)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
G protein alpha Q / GNAQ (1-359, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
G protein alpha Q / GNAQ (1-359, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
GNAQ MS Standard C13 and N15-labeled recombinant protein (NP_002063)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of GNAQ (NM_002072) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GNAQ (NM_002072) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GNAQ (NM_002072) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GNAQ
Pathways
- Gap junction