Germany
Japan
United Kingdom
China
GNAQ (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Gnaq (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein, alpha q polypeptide (Gnaq)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, GNAQ (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GNAQ (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GNAQ (GFP-tagged) - Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Gnaq (GFP-tagged) - Mouse guanine nucleotide binding protein, alpha q polypeptide (Gnaq)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Gnaq (Myc-DDK-tagged ORF) - Rat guanine nucleotide binding protein, alpha q polypeptide (Gnaq), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
GNAQ - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN409199 is the updated version of KN209199.
Gnaq - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN507067 is the updated version of KN307067.
Lenti ORF clone of Gnaq (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein, alpha q polypeptide (Gnaq)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gnaq (Myc-DDK-tagged) - Mouse guanine nucleotide binding protein, alpha q polypeptide (Gnaq), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gnaq (mGFP-tagged) - Mouse guanine nucleotide binding protein, alpha q polypeptide (Gnaq)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gnaq (GFP-tagged) - Mouse guanine nucleotide binding protein, alpha q polypeptide (Gnaq), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GNAQ (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, GNAQ (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gnaq (Myc-DDK-tagged ORF) - Rat guanine nucleotide binding protein, alpha q polypeptide (Gnaq), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gnaq (Myc-DDK-tagged ORF) - Rat guanine nucleotide binding protein, alpha q polypeptide (Gnaq), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gnaq (mGFP-tagged ORF) - Rat guanine nucleotide binding protein, alpha q polypeptide (Gnaq), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gnaq (GFP-tagged ORF) - Rat guanine nucleotide binding protein, alpha q polypeptide (Gnaq), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GNAQ (untagged)-Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Gnaq (untagged ORF) - Rat guanine nucleotide binding protein, alpha q polypeptide (Gnaq), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
GNAQ - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
GNAQ (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-GNAQ Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAQ antibody: synthetic peptide directed towards the N terminal of human GNAQ. Synthetic peptide located within the following region: DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK |
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
GNAQ HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of guanine nucleotide binding protein (G protein), q polypeptide (GNAQ)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GNAQ - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
GNAQ - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
G protein alpha Q / GNAQ (1-359, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
G protein alpha Q / GNAQ (1-359, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
GNAQ CRISPRa kit - CRISPR gene activation of human G protein subunit alpha q
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Gnaq CRISPRa kit - CRISPR gene activation of mouse guanine nucleotide binding protein, alpha q polypeptide
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene GNAQ
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene GNAQ
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Gnaq (untagged) - Mouse guanine nucleotide binding protein, alpha q polypeptide (Gnaq), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Gnaq
GNAQ MS Standard C13 and N15-labeled recombinant protein (NP_002063)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
3`UTR clone of guanine nucleotide binding protein (G protein) q polypeptide (GNAQ) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Gnaq (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Gnaq Antibody - middle region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
GNAQ Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human GNAQ |
GNAQ Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-359 of human GNAQ (NP_002063.2). |
| Modifications | Unmodified |
Transient overexpression of GNAQ (NM_002072) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- GNAQ