Germany
Japan
United Kingdom
China
GUCY1A2 (Myc-DDK-tagged)-Human guanylate cyclase 1, soluble, alpha 2 (GUCY1A2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti-ORF clone of GUCY1A2 (Myc-DDK-tagged)-Human guanylate cyclase 1, soluble, alpha 2 (GUCY1A2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GUCY1A2 (Myc-DDK-tagged)-Human guanylate cyclase 1, soluble, alpha 2 (GUCY1A2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GUCY1A2 (mGFP-tagged)-Human guanylate cyclase 1, soluble, alpha 2 (GUCY1A2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GUCY1A2 (mGFP-tagged)-Human guanylate cyclase 1, soluble, alpha 2 (GUCY1A2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GUCY1A2 (Myc-DDK tagged) - Homo sapiens guanylate cyclase 1, soluble, alpha 2 (GUCY1A2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GUCY1A2 (GFP-tagged) - Human guanylate cyclase 1, soluble, alpha 2 (GUCY1A2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GUCY1A2 (GFP-tagged) - Homo sapiens guanylate cyclase 1, soluble, alpha 2 (GUCY1A2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GUCY1A2 (untagged)-Human guanylate cyclase 1, soluble, alpha 2 (GUCY1A2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of guanylate cyclase 1, soluble, alpha 2 (GUCY1A2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GUCY1A2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-GUCY1A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GUCY1A2 antibody is: synthetic peptide directed towards the N-terminal region of Human GUCY1A2. Synthetic peptide located within the following region: KNFHNISNRCSYADHSNKEEIEDVSGILQCTANILGLKFEEIQKRFGEEF |
GUCY1A2 (untagged) - Homo sapiens guanylate cyclase 1, soluble, alpha 2 (GUCY1A2), transcript variant 1
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of GUCY1A2 (NM_000855) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GUCY1A2 (NM_001256424) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GUCY1A2 (NM_000855) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GUCY1A2 (NM_000855) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GUCY1A2 (NM_001256424) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GUCY1A2
Pathways
- Gap junction