USD 98.00
USD 390.00
In Stock
GPX4 (Myc-DDK-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 1, (Note, selenocysteine protein, internal stop codon, see reference data summary)
| Vector | pCMV6-Entry |
| Mammalian Cell Selection | Neomycin |
GPX4 (GFP-tagged) - Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 1, (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
| Vector | pCMV6-AC-GFP |
| Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, GPX4 (Myc-DDK-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 1, (Note, selenocystein protein, internal stop codon, see summary), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
USD 820.00
3 Weeks
Lenti ORF particles, GPX4 (mGFP-tagged) - Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 1, (Note: selenocystein protein, Internal stop codon present. See Summary below), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
USD 820.00
6 Weeks
Lenti ORF particles, GPX4 (Myc-DDK-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 2, (Note, selenocystein protein, internal stop codon, see summary), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
USD 820.00
3 Weeks
Lenti ORF particles, GPX4 (mGFP-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 2, (Note, selenocystein protein, internal stop codon, see summary), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
USD 820.00
6 Weeks
Lenti ORF particles, GPX4 (Myc-DDK-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 3, (Note, selenocystein protein, internal stop codon, see summary), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
USD 820.00
3 Weeks
Lenti ORF particles, GPX4 (mGFP-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 3, (Note, selenocystein protein, internal stop codon, see summary), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
GPX4 (GFP-tagged) - Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 2, (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
| Vector | pCMV6-AC-GFP |
| Mammalian Cell Selection | Neomycin |
GPX4 (GFP-tagged) - Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 3, (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
| Vector | pCMV6-AC-GFP |
| Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, GPX4 (Myc-DDK-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 1, (Note, selenocystein protein, internal stop codon, see summary), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
Lenti-ORF, GPX4 (mGFP-tagged) - Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 1, (Note: selenocystein protein, Internal stop codon present. See Summary below)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, GPX4 (mGFP-tagged) - Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 1, (Note: selenocystein protein, Internal stop codon present. See Summary below), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
GPX4 (Myc-DDK-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 2, (Note, selenocysteine protein, internal stop codon, see reference data summary)
| Vector | pCMV6-Entry |
| Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of GPX4 (Myc-DDK-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 2, (Note, selenocystein protein, internal stop codon, see summary)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
USD 820.00
11 Weeks
Lenti ORF particles, GPX4 (Myc-DDK-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 2, (Note, selenocystein protein, internal stop codon, see summary), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GPX4 (mGFP-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 2, (Note, selenocystein protein, internal stop codon, see summary)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
USD 820.00
11 Weeks
Lenti ORF particles, GPX4 (mGFP-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 2, (Note, selenocystein protein, internal stop codon, see summary), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
GPX4 (Myc-DDK-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 3, (Note, selenocysteine protein, internal stop codon, see reference data summary)
| Vector | pCMV6-Entry |
| Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of GPX4 (Myc-DDK-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 3, (Note, selenocystein protein, internal stop codon, see summary)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
USD 820.00
11 Weeks
Lenti ORF particles, GPX4 (Myc-DDK-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 3, (Note, selenocystein protein, internal stop codon, see summary), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GPX4 (mGFP-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 3, (Note, selenocystein protein, internal stop codon, see summary)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
USD 820.00
11 Weeks
Lenti ORF particles, GPX4 (mGFP-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 3, (Note, selenocystein protein, internal stop codon, see summary), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
Glutathione Peroxidase 4 (184-196) goat polyclonal antibody, Purified from goat serum by ammonium sulphate precipitation followed by antigen affinity chromatography using the immunizing peptide.
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EEPLVIEKDLPHY, from the C-Terminus of protein sequence according to NP_002076.2NP_001034937.1. |
Lenti-ORF, GPX4 (Myc-DDK-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 1, (Note, selenocystein protein, internal stop codon, see summary)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
GPX4 (untagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 1 (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
| Vector | pCMV6-AC |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-GPX4 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPX4 antibody: synthetic peptide directed towards the middle region of human GPX4. Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA |
GPX4 (untagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 1 (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
| Vector | pCMV6-XL5 |
| Mammalian Cell Selection | None |
Lenti-ORF clone of GPX4 (Myc-DDK-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 2, (Note, selenocystein protein, internal stop codon, see summary)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
Lenti-ORF clone of GPX4 (Myc-DDK-tagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 3, (Note, selenocystein protein, internal stop codon, see summary)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
GPX4 (untagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 3 (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
| Vector | pCMV6-Entry |
| Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 1, Gly73-End, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
USD 121.00
2 Weeks
GPX4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GPX4 (untagged)-Human glutathione peroxidase 4 (phospholipid hydroperoxidase) (GPX4), transcript variant 2 (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
| Vector | pCMV6 series |
Transient overexpression of GPX4 (NM_002085) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPX4 (NM_001039847) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPX4 (NM_001039848) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPX4 (NM_002085) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GPX4 (NM_002085) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GPX4 (NM_001039847) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GPX4 (NM_001039848) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Germany
Japan
United Kingdom
China
