Products

View as table Download

USD 98.00

USD 390.00

In Stock

GSTA3 (Myc-DDK-tagged)-Human glutathione S-transferase alpha 3 (GSTA3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, GSTA3 (Myc-DDK tagged) - Human glutathione S-transferase alpha 3 (GSTA3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, GSTA3 (mGFP-tagged) - Human glutathione S-transferase alpha 3 (GSTA3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

GSTA3 (GFP-tagged) - Human glutathione S-transferase alpha 3 (GSTA3)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GSTA3 (Myc-DDK tagged) - Human glutathione S-transferase alpha 3 (GSTA3), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GSTA3 (mGFP-tagged) - Human glutathione S-transferase alpha 3 (GSTA3), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

GSTA3 (untagged)-Human glutathione S-transferase alpha 3 (GSTA3)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-GSTA3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTA3 antibody: synthetic peptide directed towards the middle region of human GSTA3. Synthetic peptide located within the following region: SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR

GSTA3 mouse monoclonal antibody, clone 1F11

Applications ELISA, IHC, WB
Reactivities Human

Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

GSTA3 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GSTA3.

GSTA3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of glutathione S-transferase alpha 3 (GSTA3)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

GSTA3 MS Standard C13 and N15-labeled recombinant protein (NP_000838)

Tag C-Myc/DDK
Expression Host HEK293

Rabbit Polyclonal Anti-GSTA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GSTA3

USD 1,040.00

4 Weeks

Transient overexpression of GSTA3 (NM_000847) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of GSTA3 (NM_000847) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of GSTA3 (NM_000847) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack