GSTA3 (Myc-DDK-tagged)-Human glutathione S-transferase alpha 3 (GSTA3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GSTA3 (Myc-DDK-tagged)-Human glutathione S-transferase alpha 3 (GSTA3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human glutathione S-transferase alpha 3 (GSTA3)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, GSTA3 (Myc-DDK tagged) - Human glutathione S-transferase alpha 3 (GSTA3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GSTA3 (mGFP-tagged) - Human glutathione S-transferase alpha 3 (GSTA3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GSTA3 (GFP-tagged) - Human glutathione S-transferase alpha 3 (GSTA3)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GSTA3 (Myc-DDK tagged) - Human glutathione S-transferase alpha 3 (GSTA3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GSTA3 (mGFP-tagged) - Human glutathione S-transferase alpha 3 (GSTA3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
GSTA3 (untagged)-Human glutathione S-transferase alpha 3 (GSTA3)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GSTA3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GSTA3 antibody: synthetic peptide directed towards the middle region of human GSTA3. Synthetic peptide located within the following region: SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR |
GSTA3 mouse monoclonal antibody, clone 1F11
Applications | ELISA, IHC, WB |
Reactivities | Human |
Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
GSTA3 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GSTA3. |
GSTA3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of glutathione S-transferase alpha 3 (GSTA3)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GSTA3 MS Standard C13 and N15-labeled recombinant protein (NP_000838)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-GSTA3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GSTA3 |
Transient overexpression of GSTA3 (NM_000847) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GSTA3 (NM_000847) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GSTA3 (NM_000847) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack