Germany
Japan
United Kingdom
China
GSTA3 (Myc-DDK-tagged)-Human glutathione S-transferase alpha 3 (GSTA3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human glutathione S-transferase alpha 3 (GSTA3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, GSTA3 (Myc-DDK tagged) - Human glutathione S-transferase alpha 3 (GSTA3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GSTA3 (mGFP-tagged) - Human glutathione S-transferase alpha 3 (GSTA3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GSTA3 (GFP-tagged) - Human glutathione S-transferase alpha 3 (GSTA3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Gsta3 (Myc-DDK-tagged) - Mouse glutathione S-transferase, alpha 3 (Gsta3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Gsta3 (myc-DDK-tagged) - Mouse glutathione S-transferase, alpha 3 (Gsta3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GSTA3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN404624 is the updated version of KN204624.
Gsta3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN507390 is the updated version of KN307390.
Gsta3 (GFP-tagged) - Mouse glutathione S-transferase, alpha 3 (Gsta3), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Gsta3 (Myc-DDK-tagged) - Mouse glutathione S-transferase, alpha 3 (Gsta3), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gsta3 (Myc-DDK-tagged) - Mouse glutathione S-transferase, alpha 3 (Gsta3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gsta3 (mGFP-tagged) - Mouse glutathione S-transferase, alpha 3 (Gsta3), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gsta3 (GFP-tagged) - Mouse glutathione S-transferase, alpha 3 (Gsta3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Gsta3 (myc-DDK-tagged) - Mouse glutathione S-transferase, alpha 3 (Gsta3), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GSTA3 (Myc-DDK tagged) - Human glutathione S-transferase alpha 3 (GSTA3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GSTA3 (mGFP-tagged) - Human glutathione S-transferase alpha 3 (GSTA3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Gsta5 (Myc-DDK-tagged ORF) - Rat glutathione S-transferase Yc2 subunit (Yc2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Gsta5 (Myc-DDK-tagged ORF) - Rat glutathione S-transferase Yc2 subunit (Yc2), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gsta5 (Myc-DDK-tagged ORF) - Rat glutathione S-transferase Yc2 subunit (Yc2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gsta5 (mGFP-tagged ORF) - Rat glutathione S-transferase Yc2 subunit (Yc2), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gsta5 (GFP-tagged ORF) - Rat glutathione S-transferase Yc2 subunit (Yc2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Gsta3 (myc-DDK-tagged) - Rat glutathione S-transferase alpha 3 (Gsta3), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Gsta3 (myc-DDK-tagged) - Rat glutathione S-transferase alpha 3 (Gsta3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
GSTA3 (untagged)-Human glutathione S-transferase alpha 3 (GSTA3)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GSTA3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GSTA3 antibody: synthetic peptide directed towards the middle region of human GSTA3. Synthetic peptide located within the following region: SSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFR |
Gsta3 (untagged) - Mouse glutathione S-transferase, alpha 3 (Gsta3), transcript variant 1, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human glutathione S-transferase alpha 3 (GSTA3), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Gsta3 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
GSTA3 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
GSTA3 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GSTA3. |
GSTA3 CRISPRa kit - CRISPR gene activation of human glutathione S-transferase alpha 3
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Gsta3 CRISPRa kit - CRISPR gene activation of mouse glutathione S-transferase, alpha 3
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene GSTA3
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene GSTA3
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
GSTA3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of glutathione S-transferase alpha 3 (GSTA3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Gsta3 (untagged) - Mouse glutathione S-transferase, alpha 3 (Gsta3), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Gsta3 (untagged) - Mouse glutathione S-transferase, alpha 3 (Gsta3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Gsta3
GSTA3 MS Standard C13 and N15-labeled recombinant protein (NP_000838)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Gsta5 (untagged ORF) - Rat glutathione S-transferase Yc2 subunit (Yc2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Gsta3 (untagged) - Rat glutathione S-transferase alpha 3 (Gsta3), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Gsta3 (untagged) - Rat glutathione S-transferase alpha 3 (Gsta3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of glutathione S-transferase alpha 3 (GSTA3) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Gsta3 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Active filters
Target Symbol
- GSTA3