Products

Proteins (13)
cDNA Clones (12)
Antibodies (1)
Jump to Filters
View as table Download
LYPLA2 (NM_007260) Human Tagged ORF Clone
RC202021

USD 98.00

USD 390.00

In Stock

LYPLA2 (Myc-DDK-tagged)-Human lysophospholipase II (LYPLA2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
LYPLA2 (NM_007260) Human Tagged ORF Clone
RG202021

USD 460.00

In Stock

LYPLA2 (GFP-tagged) - Human lysophospholipase II (LYPLA2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LYPLA2 (NM_007260) Human Tagged ORF Clone
RC202021L3

USD 620.00

3 Weeks

Lenti ORF clone of Human lysophospholipase II (LYPLA2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LYPLA2 (NM_007260) Human Untagged Clone
SC115622

USD 310.00

In Stock

LYPLA2 (untagged)-Human lysophospholipase II (LYPLA2)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
LYPLA2 (NM_007260) Human Tagged ORF Clone
RC202021L1

USD 768.00

In Stock

Lenti ORF clone of Human lysophospholipase II (LYPLA2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
LYPLA2 Rabbit Polyclonal Antibody
TA344253

USD 475.00

5 Days

Rabbit Polyclonal Anti-LYPLA2 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LYPLA2 antibody: synthetic peptide directed towards the N terminal of human LYPLA2. Synthetic peptide located within the following region: MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP
LYPLA2 (NM_007260) Human Untagged Clone
SC324073

USD 310.00

In Stock

LYPLA2 (untagged)-Human lysophospholipase II (LYPLA2)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
LYPLA2 (NM_007260) Human Tagged ORF Clone
RC202021L2

USD 620.00

3 Weeks

Lenti ORF clone of Human lysophospholipase II (LYPLA2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
LYPLA2 (NM_007260) Human Over-expression Lysate
LY416098

USD 396.00

5 Days

Transient overexpression lysate of lysophospholipase II (LYPLA2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LYPLA2 (1-231, His-tag) Human Protein
AR09866PU-L

USD 1,105.00

2 Weeks

LYPLA2 (1-231, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
LYPLA2 (1-231, His-tag) Human Protein
AR09866PU-N

USD 415.00

2 Weeks

LYPLA2 (1-231, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
LYPLA2 (NM_007260) Human Over-expression Lysate
LC416098

USD 121.00

2 Weeks

LYPLA2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LYPLA2 (NM_007260) Human Mass Spec Standard
PH302021

USD 2,055.00

3 Weeks

LYPLA2 MS Standard C13 and N15-labeled recombinant protein (NP_009191)

Tag C-Myc/DDK
Expression Host HEK293
LYPLA2 (NM_007260) ICC Control Block
TB402021

USD 1,040.00

4 Weeks

Transient overexpression of LYPLA2 (NM_007260) in HEK293T cells paraffin embedded controls for ICC/IHC staining

LYPLA2 (NM_007260) Human Recombinant Protein
TP720900

USD 330.00

3 Weeks

Purified recombinant protein of Human lysophospholipase II (LYPLA2)

Tag C-His
Expression Host E. coli
LYPLA2 (NM_007260) Human Recombinant Protein
TP720900L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human lysophospholipase II (LYPLA2)

Tag C-His
Expression Host E. coli
LYPLA2 (NM_007260) Human Recombinant Protein
TP720900M

USD 760.00

3 Weeks

Purified recombinant protein of Human lysophospholipase II (LYPLA2)

Tag C-His
Expression Host E. coli
LYPLA2 (NM_007260) Human Recombinant Protein
TP720900XL

USD 2,800.00

3 Weeks

Purified recombinant protein of Human lysophospholipase II (LYPLA2)

Tag C-His
Expression Host E. coli
LYPLA2 Cytosection
TS402021

USD 225.00

4 Weeks

Transient overexpression of LYPLA2 (NM_007260) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

LYPLA2 Cytosection
TS402021P5

USD 889.00

4 Weeks

Transient overexpression of LYPLA2 (NM_007260) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack