Products

cDNA Clones (21)
Antibodies (16)
Proteins (15)
Jump to Filters
View as table Download
ALAS2 (NM_001037967) Human Tagged ORF Clone
RC206567

USD 420.00

In Stock

ALAS2 (Myc-DDK-tagged)-Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ALAS2 (NM_001037968) Human Tagged ORF Clone
RC218323

USD 420.00

In Stock

ALAS2 (Myc-DDK-tagged)-Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ALAS2 (NM_000032) Human Tagged ORF Clone
RC219079

USD 480.00

In Stock

ALAS2 (Myc-DDK-tagged)-Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ALAS2 (NM_001037967) Human Tagged ORF Clone
RC206567L3

USD 620.00

3 Weeks

Lenti ORF clone of Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ALAS2 (NM_001037967) Human Tagged ORF Clone Lentiviral Particle
RC206567L3V

USD 820.00

6 Weeks

Lenti ORF particles, ALAS2 (Myc-DDK tagged) - Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ALAS2 (NM_001037967) Human Tagged ORF Clone
RC206567L4

USD 620.00

3 Weeks

Lenti ORF clone of Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ALAS2 (NM_001037967) Human Tagged ORF Clone Lentiviral Particle
RC206567L4V

USD 820.00

6 Weeks

Lenti ORF particles, ALAS2 (mGFP-tagged) - Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ALAS2 (NM_001037968) Human Tagged ORF Clone
RC218323L3

USD 620.00

3 Weeks

Lenti-ORF clone of ALAS2 (Myc-DDK-tagged)-Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ALAS2 (NM_001037968) Human Tagged ORF Clone Lentiviral Particle
RC218323L3V

USD 820.00

6 Weeks

Lenti ORF particles, ALAS2 (Myc-DDK-tagged)-Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ALAS2 (NM_001037968) Human Tagged ORF Clone
RC218323L4

USD 620.00

3 Weeks

Lenti-ORF clone of ALAS2 (mGFP-tagged)-Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ALAS2 (NM_001037968) Human Tagged ORF Clone Lentiviral Particle
RC218323L4V

USD 820.00

6 Weeks

Lenti ORF particles, ALAS2 (mGFP-tagged)-Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ALAS2 (NM_000032) Human Tagged ORF Clone
RC219079L3

USD 680.00

3 Weeks

Lenti-ORF clone of ALAS2 (Myc-DDK-tagged)-Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ALAS2 (NM_000032) Human Tagged ORF Clone Lentiviral Particle
RC219079L3V

USD 880.00

6 Weeks

Lenti ORF particles, ALAS2 (Myc-DDK-tagged)-Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ALAS2 (NM_000032) Human Tagged ORF Clone
RC219079L4

USD 680.00

3 Weeks

Lenti-ORF clone of ALAS2 (mGFP-tagged)-Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ALAS2 (NM_000032) Human Tagged ORF Clone Lentiviral Particle
RC219079L4V

USD 880.00

6 Weeks

Lenti ORF particles, ALAS2 (mGFP-tagged)-Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ALAS2 (NM_001037967) Human Tagged ORF Clone
RG206567

USD 460.00

3 Weeks

ALAS2 (GFP-tagged) - Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ALAS2 (NM_001037968) Human Tagged ORF Clone
RG218323

USD 460.00

3 Weeks

ALAS2 (GFP-tagged) - Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ALAS2 (NM_000032) Human Tagged ORF Clone
RG219079

USD 530.00

3 Weeks

ALAS2 (GFP-tagged) - Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ALAS2 (NM_001037968) Human Untagged Clone
SC302946

USD 760.00

In Stock

ALAS2 (untagged)-Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ALAS2 Rabbit Polyclonal Antibody
TA346264

USD 410.00

5 Days

Rabbit Polyclonal Anti-ALAS2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALAS2 antibody: synthetic peptide directed towards the N terminal of human ALAS2. Synthetic peptide located within the following region: VFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQ
ALAS2 Rabbit Polyclonal Antibody
TA349459

USD 380.00

In Stock

Rabbit Polyclonal Anti-ALAS2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ALAS2
ALAS2 Rabbit Polyclonal Antibody
TA308176

USD 415.00

In Stock

Rabbit Polyclonal antibody to ALAS-E (aminolevulinate, delta-, synthase 2)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 211 and 587 of ALAS-E (Uniprot ID#P22557)
ALAS2 Rabbit Polyclonal Antibody
TA346149

USD 475.00

5 Days

Rabbit Polyclonal Anti-ALAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALAS2 antibody: synthetic peptide directed towards the N terminal of human ALAS2. Synthetic peptide located within the following region: CPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQK
ALAS2 Rabbit Polyclonal Antibody
TA346150

USD 475.00

5 Days

Rabbit Polyclonal Anti-ALAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALAS2 antibody: synthetic peptide directed towards the C terminal of human ALAS2. Synthetic peptide located within the following region: PTVPRGEELLRLAPSPHHSPQMMEDFVEKLLLAWTAVGLPLQDVSVAACN
ALAS2 Rabbit Polyclonal Antibody
TA346263

USD 475.00

5 Days

Rabbit Polyclonal Anti-ALAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALAS2 antibody: synthetic peptide directed towards the C terminal of human ALAS2. Synthetic peptide located within the following region: VRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGNAA
ALAS2 (NM_000032) Human Over-expression Lysate
LC424966

USD 187.00

In Stock

ALAS2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ALAS2 (NM_001037967) Human Untagged Clone
SC323829

USD 760.00

In Stock

ALAS2 (untagged)-Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
ALAS2 (NM_001037968) Human Over-expression Lysate
LC421997

USD 187.00

In Stock

ALAS2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ALAS2 (NM_000032) Human Over-expression Lysate
LY424966

USD 605.00

In Stock

Transient overexpression lysate of aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ALAS2 Mouse Monoclonal Antibody [Clone ID: OTI2D3]
CF809959

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ALAS2 mouse monoclonal antibody,clone OTI2D3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ALAS2 Mouse Monoclonal Antibody [Clone ID: OTI2E4]
CF810000

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ALAS2 mouse monoclonal antibody,clone OTI2E4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ALAS2 (NM_001037967) Human Over-expression Lysate
LC421996

USD 121.00

2 Weeks

ALAS2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ALAS2 (NM_001037967) Human Over-expression Lysate
LY421996

USD 396.00

5 Days

Transient overexpression lysate of aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ALAS2 (NM_001037968) Human Over-expression Lysate
LY421997

USD 605.00

5 Days

Transient overexpression lysate of aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ALAS2 (NM_000032) Human Untagged Clone
SC314112

USD 1,000.00

4 Weeks

ALAS2 (untagged)-Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6 series
Tag Tag Free
ALAS2 Mouse Monoclonal Antibody [Clone ID: OTI2D3]
TA809959

USD 379.00

In Stock

ALAS2 mouse monoclonal antibody,clone OTI2D3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ALAS2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D3]
TA809959AM

USD 420.00

4 Weeks

ALAS2 mouse monoclonal antibody,clone OTI2D3, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
ALAS2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D3]
TA809959BM

USD 420.00

4 Weeks

ALAS2 mouse monoclonal antibody,clone OTI2D3, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
ALAS2 Mouse Monoclonal Antibody [Clone ID: OTI2D3]
TA809959S

USD 159.00

2 Days

ALAS2 mouse monoclonal antibody,clone OTI2D3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ALAS2 Mouse Monoclonal Antibody [Clone ID: OTI2E4]
TA810000

USD 379.00

In Stock

ALAS2 mouse monoclonal antibody,clone OTI2E4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ALAS2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E4]
TA810000AM

USD 420.00

4 Weeks

ALAS2 mouse monoclonal antibody,clone OTI2E4, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
ALAS2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E4]
TA810000BM

USD 420.00

4 Weeks

ALAS2 mouse monoclonal antibody,clone OTI2E4, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
ALAS2 Mouse Monoclonal Antibody [Clone ID: OTI2E4]
TA810000S

USD 159.00

2 Days

ALAS2 mouse monoclonal antibody,clone OTI2E4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ALAS2 ICC Control Block
TB406567

USD 1,070.00

4 Weeks

Transient overexpression of ALAS2 (NM_001037967) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ALAS2 ICC Control Block
TB418323

USD 1,070.00

4 Weeks

Transient overexpression of ALAS2 (NM_001037968) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ALAS2 ICC Control Block
TB419079

USD 1,130.00

4 Weeks

Transient overexpression of ALAS2 (NM_000032) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ALAS2 Cytosection
TS406567

USD 225.00

4 Weeks

Transient overexpression of ALAS2 (NM_001037967) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ALAS2 Cytosection
TS406567P5

USD 889.00

4 Weeks

Transient overexpression of ALAS2 (NM_001037967) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ALAS2 Cytosection
TS418323

USD 225.00

4 Weeks

Transient overexpression of ALAS2 (NM_001037968) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ALAS2 Cytosection
TS418323P5

USD 889.00

4 Weeks

Transient overexpression of ALAS2 (NM_001037968) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack