Products

View as table Download

GLYCTK (Myc-DDK-tagged)-Human glycerate kinase (GLYCTK), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

GLYCTK (GFP-tagged) - Human glycerate kinase (GLYCTK), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human glycerate kinase (GLYCTK), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GLYCTK (Myc-DDK tagged) - Human glycerate kinase (GLYCTK), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human glycerate kinase (GLYCTK), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GLYCTK (mGFP-tagged) - Human glycerate kinase (GLYCTK), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

GLYCTK (Myc-DDK-tagged)-Human glycerate kinase (GLYCTK), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of GLYCTK (Myc-DDK-tagged)-Human glycerate kinase (GLYCTK), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of GLYCTK (mGFP-tagged)-Human glycerate kinase (GLYCTK), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

GLYCTK (GFP-tagged) - Human glycerate kinase (GLYCTK), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit polyclonal anti-GLCTK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GLCTK.

GLYCTK (untagged)-Human glycerate kinase (GLYCTK), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

GLYCTK (untagged)-Human glycerate kinase (GLYCTK), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal antibody to GLYCTK (glycerate kinase)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 144 and 523 of GLYCTK (Uniprot ID#Q8IVS8)

Rabbit Polyclonal Anti-GLYCTK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLYCTK antibody: synthetic peptide directed towards the N terminal of human GLYCTK. Synthetic peptide located within the following region: IQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGA

Rabbit Polyclonal Anti-GLYCTK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLYCTK antibody: synthetic peptide directed towards the middle region of human GLYCTK. Synthetic peptide located within the following region: KPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGS

GLYCTK HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of glycerate kinase (GLYCTK), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

GLYCTK MS Standard C13 and N15-labeled recombinant protein (NP_660305)

Tag C-Myc/DDK
Expression Host HEK293

(untagged)-Human cDNA FLJ23635 fis, clone CAS05365

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Transient overexpression of GLYCTK (NM_145262) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of GLYCTK (NM_001144951) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of GLYCTK (NM_145262) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of GLYCTK (NM_145262) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of GLYCTK (NM_001144951) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack