Products

cDNA Clones (26)
Proteins (18)
Antibodies (3)
Jump to Filters
View as table Download
SHMT1 (NM_004169) Human Tagged ORF Clone
RC203461

USD 420.00

In Stock

SHMT1 (Myc-DDK-tagged)-Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SHMT1 (NM_148918) Human Tagged ORF Clone
RC205102

USD 420.00

In Stock

SHMT1 (Myc-DDK-tagged)-Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SHMT1 (NM_004169) Human Tagged ORF Clone Lentiviral Particle
RC203461L1V

USD 820.00

3 Weeks

Lenti ORF particles, SHMT1 (Myc-DDK tagged) - Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SHMT1 (NM_004169) Human Tagged ORF Clone Lentiviral Particle
RC203461L2V

USD 820.00

6 Weeks

Lenti ORF particles, SHMT1 (mGFP-tagged) - Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SHMT1 (NM_148918) Human Tagged ORF Clone Lentiviral Particle
RC205102L1V

USD 820.00

3 Weeks

Lenti ORF particles, SHMT1 (Myc-DDK tagged) - Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SHMT1 (NM_148918) Human Tagged ORF Clone Lentiviral Particle
RC205102L2V

USD 820.00

6 Weeks

Lenti ORF particles, SHMT1 (mGFP-tagged) - Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SHMT1 (NM_004169) Human Tagged ORF Clone
RG203461

USD 460.00

In Stock

SHMT1 (GFP-tagged) - Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SHMT1 (NM_148918) Human Tagged ORF Clone
RG205102

USD 460.00

In Stock

SHMT1 (GFP-tagged) - Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SHMT1 (NM_004169) Human Tagged ORF Clone
RC203461L3

USD 620.00

3 Weeks

Lenti ORF clone of Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT1 (NM_004169) Human Tagged ORF Clone Lentiviral Particle
RC203461L3V

USD 820.00

6 Weeks

Lenti ORF particles, SHMT1 (Myc-DDK tagged) - Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT1 (NM_004169) Human Tagged ORF Clone
RC203461L4

USD 620.00

3 Weeks

Lenti ORF clone of Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT1 (NM_004169) Human Tagged ORF Clone Lentiviral Particle
RC203461L4V

USD 820.00

6 Weeks

Lenti ORF particles, SHMT1 (mGFP-tagged) - Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT1 (NM_148918) Human Tagged ORF Clone
RC205102L3

USD 620.00

3 Weeks

Lenti ORF clone of Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT1 (NM_148918) Human Tagged ORF Clone Lentiviral Particle
RC205102L3V

USD 820.00

5 Weeks

Lenti ORF particles, SHMT1 (Myc-DDK tagged) - Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT1 (NM_148918) Human Tagged ORF Clone Lentiviral Particle
RC205102L4V

USD 820.00

3 Weeks

Lenti ORF particles, SHMT1 (mGFP-tagged) - Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT1 (NM_001281786) Human Tagged ORF Clone
RC237604

USD 420.00

2 Weeks

SHMT1 (myc-DDK-tagged) - Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SHMT1 (NM_004169) Human Tagged ORF Clone
RC203461L1

USD 768.00

In Stock

Lenti ORF clone of Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SHMT1 (NM_148918) Human Tagged ORF Clone
RC205102L4

USD 768.00

In Stock

Lenti ORF clone of Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SHMT1 (NM_004169) Human Untagged Clone
SC321518

USD 310.00

In Stock

SHMT1 (untagged)-Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
SHMT1 (NM_148918) Human Tagged ORF Clone
RC205102L1

USD 620.00

In Stock

Lenti ORF clone of Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SHMT1 (374-483) Mouse Monoclonal Antibody [Clone ID: 4F9]
AM20941PU-N

USD 480.00

2 Weeks

SHMT1 (374-483) mouse monoclonal antibody, clone 4F9, Purified

Applications ELISA, IHC, WB
Reactivities Human
SHMT1 (NM_004169) Human Tagged ORF Clone
RC203461L2

USD 620.00

3 Weeks

Lenti ORF clone of Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SHMT1 (NM_148918) Human Tagged ORF Clone
RC205102L2

USD 620.00

3 Weeks

Lenti ORF clone of Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SHMT1 (NM_004169) Human Over-expression Lysate
LY401341

USD 396.00

5 Days

Transient overexpression lysate of serine hydroxymethyltransferase 1 (soluble) (SHMT1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SHMT1 (NM_148918) Human Untagged Clone
SC127313

USD 310.00

2 Weeks

SHMT1 (untagged)-Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SHMT1 Rabbit Polyclonal Antibody
TA330971

USD 375.00

5 Days

Rabbit polyclonal Anti-SHMT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT1 antibody: synthetic peptide directed towards the N terminal of human SHMT1. Synthetic peptide located within the following region: NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG
SHMT1 / SHMT (1-483, His-tag) Human Protein
AR50135PU-N

USD 845.00

2 Weeks

SHMT1 / SHMT (1-483, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
SHMT1 / SHMT (1-483, His-tag) Human Protein
AR50135PU-S

USD 330.00

2 Weeks

SHMT1 / SHMT (1-483, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
SHMT1 (NM_004169) Human Over-expression Lysate
LC401341

USD 121.00

2 Weeks

SHMT1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
SHMT1 (NM_148918) Human Over-expression Lysate
LC407729

USD 121.00

2 Weeks

SHMT1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SHMT1 (NM_148918) Human Over-expression Lysate
LY407729

USD 396.00

5 Days

Transient overexpression lysate of serine hydroxymethyltransferase 1 (soluble) (SHMT1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SHMT1 (NM_004169) Human Mass Spec Standard
PH303461

USD 2,055.00

3 Weeks

SHMT1 MS Standard C13 and N15-labeled recombinant protein (NP_004160)

Tag C-Myc/DDK
Expression Host HEK293
SHMT1 (NM_148918) Human Mass Spec Standard
PH305102

USD 2,055.00

3 Weeks

SHMT1 MS Standard C13 and N15-labeled recombinant protein (NP_683718)

Tag C-Myc/DDK
Expression Host HEK293
SHMT1 (NM_001281786) Human Tagged ORF Clone
RG237604

USD 460.00

2 Weeks

SHMT1 (GFP-tagged) - Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SHMT1 (AK091498) Human Untagged Clone
SC311605

USD 960.00

3 Weeks

(untagged)-Human cDNA FLJ34179 fis, clone FCBBF3016622, weakly similar to SERINE HYDROXYMETHYLTRANSFERASE, CYTOSOLIC (EC 2.1.2.1)

Vector pCMV6 series
Tag Tag Free
SHMT1 (NM_001281786) Human Untagged Clone
SC335498

USD 350.00

2 Weeks

SHMT1 (untagged) - Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SHMT1 Rabbit Polyclonal Antibody
TA356763

USD 360.00

5 Days

SHMT1 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence LVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALT
SHMT1 ICC Control Block
TB403461

USD 1,070.00

4 Weeks

Transient overexpression of SHMT1 (NM_004169) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SHMT1 ICC Control Block
TB405102

USD 1,070.00

4 Weeks

Transient overexpression of SHMT1 (NM_148918) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SHMT1 ICC Control Block
TB437604

USD 1,070.00

4 Weeks

Transient overexpression of SHMT1 (NM_001281786) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SHMT1 Cytosection
TS403461

USD 225.00

4 Weeks

Transient overexpression of SHMT1 (NM_004169) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SHMT1 Cytosection
TS403461P5

USD 889.00

4 Weeks

Transient overexpression of SHMT1 (NM_004169) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SHMT1 Cytosection
TS405102

USD 225.00

4 Weeks

Transient overexpression of SHMT1 (NM_148918) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SHMT1 Cytosection
TS405102P5

USD 889.00

4 Weeks

Transient overexpression of SHMT1 (NM_148918) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SHMT1 ICC Control Sections
TS437604P5

USD 889.00

4 Weeks

Transient overexpression of SHMT1 (NM_001281786) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack