Products

Proteins (13)
cDNA Clones (11)
Antibodies (5)
Jump to Filters
View as table Download
Aldolase C (ALDOC) (NM_005165) Human Tagged ORF Clone
RG200333

USD 460.00

In Stock

ALDOC (GFP-tagged) - Human aldolase C, fructose-bisphosphate (ALDOC)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Aldolase C (ALDOC) (NM_005165) Human Untagged Clone
SC320621

USD 760.00

In Stock

ALDOC (untagged)-Human aldolase C, fructose-bisphosphate (ALDOC)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Aldolase C (ALDOC) Rabbit Polyclonal Antibody
TA346596

USD 475.00

5 Days

Rabbit Polyclonal Anti-ALDOC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDOC antibody: synthetic peptide directed towards the N terminal of human ALDOC. Synthetic peptide located within the following region: MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE
Aldolase C (ALDOC) (NM_005165) Human Recombinant Protein
TP721085

USD 330.00

3 Weeks

Purified recombinant protein of Human aldolase C, fructose-bisphosphate (ALDOC)

Tag C-His
Expression Host HEK293
Aldolase C (ALDOC) Rabbit Polyclonal Antibody
TA346597

USD 475.00

5 Days

Rabbit Polyclonal Anti-ALDOC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDOC antibody: synthetic peptide directed towards the C terminal of human ALDOC. Synthetic peptide located within the following region: CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA
Aldolase C (ALDOC) (C-term) Rabbit Polyclonal Antibody
AP22780PU-N

USD 440.00

2 Weeks

Aldolase C (ALDOC) (C-term) rabbit polyclonal antibody, Ig Fraction

Applications IHC, WB
Reactivities Human
Immunogen ALDOC antibody was raised against kLH conjugated synthetic peptide selected from the C-terminal region of Human ALDOC.
Epitope: C-Terminus
Aldolase C (ALDOC) (NM_005165) Human Over-expression Lysate
LY417475

USD 396.00

In Stock

Transient overexpression lysate of aldolase C, fructose-bisphosphate (ALDOC)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Aldolase C (ALDOC) (NM_005165) Human Tagged Lenti ORF Clone
RC200333L2

USD 768.00

3 Weeks

Lenti ORF clone of Human aldolase C, fructose-bisphosphate (ALDOC), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Aldolase C (ALDOC) (NM_005165) Human Untagged Clone
SC116885

USD 760.00

In Stock

ALDOC (untagged)-Human aldolase C, fructose-bisphosphate (ALDOC)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Aldolase C (ALDOC) (N-term) Rabbit Polyclonal Antibody
AP50143PU-N

USD 450.00

2 Weeks

Aldolase C (ALDOC) (N-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 79-108 amino acids from the N-terminal region of human ALDOC.
Aldolase C (ALDOC) (NM_005165) Human Over-expression Lysate
LC417475

USD 121.00

In Stock

ALDOC HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Aldolase C (ALDOC) Mouse Monoclonal Antibody [Clone ID: 859CT9.5.3]
TA324945

USD 450.00

5 Days

Mouse monoclonal ALDOC Antibody (C-term)(Ascites)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Aldolase C / ALDOC (1-364, His-tag) Human Protein
AR09920PU-L

USD 845.00

2 Weeks

Aldolase C / ALDOC (1-364, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Aldolase C / ALDOC (1-364, His-tag) Human Protein
AR09920PU-N

USD 330.00

2 Weeks

Aldolase C / ALDOC (1-364, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Aldolase C (ALDOC) (NM_005165) Human Mass Spec Standard
PH300333

USD 2,055.00

3 Weeks

ALDOC MS Standard C13 and N15-labeled recombinant protein (NP_005156)

Tag C-Myc/DDK
Expression Host HEK293
Aldolase C (ALDOC) ICC Control Block
TB400333

USD 1,210.00

4 Weeks

Transient overexpression of ALDOC (NM_005165) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Aldolase C (ALDOC) (NM_005165) Human Recombinant Protein
TP721085L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human aldolase C, fructose-bisphosphate (ALDOC)

Tag C-His
Expression Host HEK293
Aldolase C (ALDOC) (NM_005165) Human Recombinant Protein
TP721085M

USD 760.00

3 Weeks

Purified recombinant protein of Human aldolase C, fructose-bisphosphate (ALDOC)

Tag C-His
Expression Host HEK293
Aldolase C (ALDOC) (NM_005165) Human Recombinant Protein
TP721085XL

USD 2,800.00

3 Weeks

Purified recombinant protein of Human aldolase C, fructose-bisphosphate (ALDOC)

Tag C-His
Expression Host HEK293
Aldolase C (ALDOC) Cytosection
TS400333

USD 225.00

4 Weeks

Transient overexpression of ALDOC (NM_005165) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Aldolase C (ALDOC) Cytosection
TS400333P5

USD 889.00

4 Weeks

Transient overexpression of ALDOC (NM_005165) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack