Products

cDNA Clones (21)
Proteins (14)
Antibodies (2)
Jump to Filters
View as table Download
PGM1 (NM_002633) Human Tagged ORF Clone
RC205771

USD 480.00

In Stock

PGM1 (Myc-DDK-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PGM1 (NM_001172818) Human Tagged ORF Clone
RC230308

USD 480.00

In Stock

PGM1 (Myc-DDK-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PGM1 (NM_002633) Human Tagged ORF Clone
RG205771

USD 530.00

In Stock

PGM1 (GFP-tagged) - Human phosphoglucomutase 1 (PGM1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PGM1 (NM_002633) Human Tagged ORF Clone
RC205771L3

USD 680.00

3 Weeks

Lenti ORF clone of Human phosphoglucomutase 1 (PGM1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PGM1 (NM_002633) Human Tagged ORF Clone Lentiviral Particle
RC205771L3V

USD 880.00

6 Weeks

Lenti ORF particles, PGM1 (Myc-DDK tagged) - Human phosphoglucomutase 1 (PGM1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PGM1 (NM_002633) Human Tagged ORF Clone
RC205771L4

USD 680.00

3 Weeks

Lenti ORF clone of Human phosphoglucomutase 1 (PGM1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PGM1 (NM_002633) Human Tagged ORF Clone Lentiviral Particle
RC205771L4V

USD 880.00

6 Weeks

Lenti ORF particles, PGM1 (mGFP-tagged) - Human phosphoglucomutase 1 (PGM1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PGM1 (NM_001172819) Human Tagged ORF Clone
RC229949

USD 590.00

3 Weeks

PGM1 (Myc-DDK-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PGM1 (NM_001172819) Human Tagged ORF Clone
RC229949L3

USD 790.00

8 Weeks

Lenti-ORF clone of PGM1 (Myc-DDK-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PGM1 (NM_001172819) Human Tagged ORF Clone Lentiviral Particle
RC229949L3V

USD 990.00

11 Weeks

Lenti ORF particles, PGM1 (Myc-DDK-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PGM1 (NM_001172819) Human Tagged ORF Clone
RC229949L4

USD 790.00

8 Weeks

Lenti-ORF clone of PGM1 (mGFP-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PGM1 (NM_001172819) Human Tagged ORF Clone Lentiviral Particle
RC229949L4V

USD 990.00

11 Weeks

Lenti ORF particles, PGM1 (mGFP-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PGM1 (NM_001172818) Human Tagged ORF Clone
RC230308L3

USD 680.00

3 Weeks

Lenti-ORF clone of PGM1 (Myc-DDK-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PGM1 (NM_001172818) Human Tagged ORF Clone Lentiviral Particle
RC230308L3V

USD 880.00

6 Weeks

Lenti ORF particles, PGM1 (Myc-DDK-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PGM1 (NM_001172818) Human Tagged ORF Clone
RC230308L4

USD 680.00

3 Weeks

Lenti-ORF clone of PGM1 (mGFP-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PGM1 (NM_001172818) Human Tagged ORF Clone Lentiviral Particle
RC230308L4V

USD 880.00

6 Weeks

Lenti ORF particles, PGM1 (mGFP-tagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PGM1 (NM_001172819) Human Tagged ORF Clone
RG229949

USD 650.00

3 Weeks

PGM1 (GFP-tagged) - Human phosphoglucomutase 1 (PGM1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PGM1 (NM_001172818) Human Tagged ORF Clone
RG230308

USD 530.00

3 Weeks

PGM1 (GFP-tagged) - Human phosphoglucomutase 1 (PGM1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PGM1 (NM_002633) Human Untagged Clone
SC118479

USD 310.00

In Stock

PGM1 (untagged)-Human phosphoglucomutase 1 (PGM1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PGM1 (NM_001172818) Human Over-expression Lysate
LC433308

USD 121.00

In Stock

PGM1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PGM1 (NM_001172818) Human Over-expression Lysate
LY433308

USD 396.00

In Stock

Transient overexpression lysate of phosphoglucomutase 1 (PGM1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PGM1 (NM_002633) Human Over-expression Lysate
LY419204

USD 396.00

5 Days

Transient overexpression lysate of phosphoglucomutase 1 (PGM1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PGM1 Rabbit Polyclonal Antibody
TA337679

USD 375.00

5 Days

Rabbit Polyclonal Anti-PGM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGM1 antibody: synthetic peptide directed towards the middle region of human PGM1. Synthetic peptide located within the following region: TVEKADNFEYSDPVDGSISRNQGLRLIFTDGSRIVFRLSGTGSAGATIRL
PGM1 Rabbit Polyclonal Antibody
TA337680

USD 375.00

5 Days

Rabbit Polyclonal Anti-PGM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGM1 antibody: synthetic peptide directed towards the middle region of human PGM1. Synthetic peptide located within the following region: ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI
PGM1 (NM_002633) Human Over-expression Lysate
LC419204

USD 121.00

2 Weeks

PGM1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PGM1 (NM_002633) Human Mass Spec Standard
PH305771

USD 2,055.00

3 Weeks

PGM1 MS Standard C13 and N15-labeled recombinant protein (NP_002624)

Tag C-Myc/DDK
Expression Host HEK293
PGM1 (NM_001172819) Human Untagged Clone
SC328587

USD 760.00

3 Weeks

PGM1 (untagged)-Human phosphoglucomutase 1 (PGM1) transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PGM1 (NM_001172818) Human Untagged Clone
SC328946

USD 980.00

3 Weeks

PGM1 (untagged)-Human phosphoglucomutase 1 (PGM1) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PGM1 ICC Control Block
TB405771

USD 1,130.00

4 Weeks

Transient overexpression of PGM1 (NM_002633) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PGM1 ICC Control Block
TB429949

USD 1,240.00

4 Weeks

Transient overexpression of PGM1 (NM_001172819) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PGM1 ICC Control Block
TB430308

USD 1,130.00

4 Weeks

Transient overexpression of PGM1 (NM_001172818) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PGM1 Cytosection
TS405771

USD 225.00

4 Weeks

Transient overexpression of PGM1 (NM_002633) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PGM1 Cytosection
TS405771P5

USD 889.00

4 Weeks

Transient overexpression of PGM1 (NM_002633) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PGM1 ICC Control Sections
TS429949P5

USD 889.00

4 Weeks

Transient overexpression of PGM1 (NM_001172819) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PGM1 Cytosection
TS430308

USD 225.00

4 Weeks

Transient overexpression of PGM1 (NM_001172818) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PGM1 Cytosection
TS430308P5

USD 889.00

4 Weeks

Transient overexpression of PGM1 (NM_001172818) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack