Products

View as table Download

WNT2B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

USD 98.00

USD 460.00

In Stock

WNT2B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, WNT2B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, WNT2B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, WNT2B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, WNT2B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

WNT2B (GFP-tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, WNT2B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, WNT2B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, WNT2B (Myc-DDK tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, WNT2B (mGFP-tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

WNT2B (myc-DDK-tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

WNT2B (GFP-tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-WNT2B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT

Rabbit Polyclonal Anti-WNT2B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT

Lenti ORF clone of Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-WNT2B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT2B antibody: synthetic peptide directed towards the N terminal of human WNT2B. Synthetic peptide located within the following region: LRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLT

Lenti ORF clone of Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

WNT2B (untagged)-Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

WNT2B (untagged)-Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

WNT2B Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%).

Rabbit Polyclonal Anti-WNT2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT2B antibody: synthetic peptide directed towards the N terminal of human WNT2B. Synthetic peptide located within the following region: MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLL

Lenti ORF clone of Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Purified recombinant protein of Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1, Tyr250-Glu350, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli

Transient overexpression lysate of wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

WNT2B Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Immunogen WNT2B antibody was raised against synthetic 14 amino acid peptide from near N-terminus of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Platypus (100%); Opossum, Chicken (86%).

WNT2B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

WNT2B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

WNT2B (GFP-tagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

WNT2B (untagged) - Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-WNT2B Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT2B

USD 1,070.00

4 Weeks

Transient overexpression of WNT2B (NM_024494) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,110.00

4 Weeks

Transient overexpression of WNT2B (NM_004185) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of WNT2B (NM_001291880) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Purified recombinant protein of Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1, full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug

Tag N-GST and C-HIS
Expression Host E. coli

USD 225.00

4 Weeks

Transient overexpression of WNT2B (NM_024494) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of WNT2B (NM_024494) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of WNT2B (NM_004185) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of WNT2B (NM_004185) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of WNT2B (NM_001291880) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack