Products

View as table Download

IL-4 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI8D4

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700022

USD 98.00

USD 390.00

In Stock

IL4 (Myc-DDK-tagged)-Human interleukin 4 (IL4), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

IL4 (Myc-DDK-tagged)-Human interleukin 4 (IL4), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

IL4 (GFP-tagged) - Human interleukin 4 (IL4), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, IL4 (Myc-DDK-tagged)-Human interleukin 4 (IL4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, IL4 (mGFP-tagged)-Human interleukin 4 (IL4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

IL4 (GFP-tagged) - Human interleukin 4 (IL4), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of IL4 (Myc-DDK-tagged)-Human interleukin 4 (IL4), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, IL4 (Myc-DDK-tagged)-Human interleukin 4 (IL4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of IL4 (mGFP-tagged)-Human interleukin 4 (IL4), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, IL4 (mGFP-tagged)-Human interleukin 4 (IL4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human interleukin 4 (IL4), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, IL4 (Myc-DDK tagged) - Human interleukin 4 (IL4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human interleukin 4 (IL4), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, IL4 (mGFP-tagged) - Human interleukin 4 (IL4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

IL4 (untagged)-Human interleukin 4 (IL4), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti-ORF clone of IL4 (Myc-DDK-tagged)-Human interleukin 4 (IL4), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Purified recombinant protein of Human interleukin 4 (IL4), transcript variant 1.

Tag Tag Free
Expression Host E. coli

Purified recombinant protein of Human interleukin 4 (IL4), transcript variant 1

Tag Tag Free
Expression Host E. coli

IL4 (untagged)-Human interleukin 4 (IL4), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Interleukin-4 / IL4 (25-153, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli

Interleukin-4 / IL4 (25-153, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli

Interleukin-4 / IL4 human recombinant protein, 10 µg

Expression Host E. coli

Interleukin-4 / IL4 human recombinant protein, 2 µg

Expression Host E. coli

Interleukin-4 / IL4 human recombinant protein, 50 µg

Expression Host E. coli

Rabbit Polyclonal Anti-Interleukin 4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 4 Antibody: A synthesized peptide derived from human Interleukin 4

IL4 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hIL-4 (human IL-4)

Anti-Human IL-4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-4

IL4 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hIL-4 (human IL-4)

Lenti-ORF clone of IL4 (mGFP-tagged)-Human interleukin 4 (IL4), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit polyclonal anti-IL4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human IL4.

Rabbit polyclonal IL4 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4.

Recombinant protein of human Interleukin 4 (IL-4) produced in E. coli.

Tag Tag Free
Expression Host E. coli

Recombinant protein of human interleukin 4 (IL4), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

IL4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit polyclonal anti-IL-4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed recombinant human IL-4

Mouse Anti-Human IL-4 Purified (50 ug)

Reactivities Human
Conjugation Unconjugated

USD 978.00

In Stock

Transient overexpression of IL4 (NM_172348) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

IL4 mouse monoclonal antibody, clone B-S4, Azide Free

Applications FN
Reactivities Human

IL4 mouse monoclonal antibody, clone B-G28, PE

Applications FC
Reactivities Human
Conjugation PE

IL4 mouse monoclonal antibody, clone 8F-12, Aff - Purified

Applications FC
Reactivities Human

IL4 mouse monoclonal antibody, clone 8F-12, PE

Applications FC
Reactivities Human
Conjugation PE

IL4 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human

Rabbit polyclonal anti-IL-4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein.

Rabbit polyclonal IL-4 antibody Peroxidase Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein.

Rabbit polyclonal IL-4 antibody Biotin Conjugated

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein.

Biotinylated Anti-Human IL-4 Goat Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-4

Rabbit Polyclonal Anti-IL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC