Products

View as table Download

Lenti ORF particles, METTL6 (Myc-DDK tagged) - Human methyltransferase like 6 (METTL6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit polyclonal Anti-METTL6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-METTL6 antibody: synthetic peptide directed towards the N terminal of human METTL6. Synthetic peptide located within the following region: QKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTML

Transient overexpression of METTL6 (NM_152396) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of METTL6 (NM_001301792) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of METTL6 (NM_001301790) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of METTL6 (NM_001301791) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of METTL6 (NM_152396) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of METTL6 (NM_152396) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of METTL6 (NM_001301792) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of METTL6 (NM_001301790) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of METTL6 (NM_001301791) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack