METTL6 (Myc-DDK-tagged)-Human methyltransferase like 6 (METTL6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
METTL6 (Myc-DDK-tagged)-Human methyltransferase like 6 (METTL6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, METTL6 (Myc-DDK tagged) - Human methyltransferase like 6 (METTL6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, METTL6 (mGFP-tagged) - Human methyltransferase like 6 (METTL6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human methyltransferase like 6 (METTL6), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, METTL6 (Myc-DDK tagged) - Human methyltransferase like 6 (METTL6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human methyltransferase like 6 (METTL6), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, METTL6 (mGFP-tagged) - Human methyltransferase like 6 (METTL6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
METTL6 (myc-DDK-tagged) - Human methyltransferase like 6 (METTL6), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
METTL6 (myc-DDK-tagged) - Human methyltransferase like 6 (METTL6), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
METTL6 (myc-DDK-tagged) - Human methyltransferase like 6 (METTL6), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
METTL6 (GFP-tagged) - Human methyltransferase like 6 (METTL6)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human methyltransferase like 6 (METTL6), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
METTL6 (untagged)-Human methyltransferase like 6 (METTL6)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 396.00
5 Days
Transient overexpression lysate of methyltransferase like 6 (METTL6)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit polyclonal Anti-METTL6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-METTL6 antibody: synthetic peptide directed towards the N terminal of human METTL6. Synthetic peptide located within the following region: QKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTML |
USD 121.00
2 Weeks
METTL6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 2,055.00
3 Weeks
METTL6 MS Standard C13 and N15-labeled recombinant protein (NP_689609)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
METTL6 (GFP-tagged) - Human methyltransferase like 6 (METTL6), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
METTL6 (GFP-tagged) - Human methyltransferase like 6 (METTL6), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
METTL6 (GFP-tagged) - Human methyltransferase like 6 (METTL6), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
METTL6 (untagged)-Human methyltransferase like 6 (METTL6)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
METTL6 (untagged) - Human methyltransferase like 6 (METTL6), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
METTL6 (untagged) - Human methyltransferase like 6 (METTL6), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
METTL6 (untagged) - Human methyltransferase like 6 (METTL6), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of METTL6 (NM_152396) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of METTL6 (NM_001301792) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of METTL6 (NM_001301790) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of METTL6 (NM_001301791) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of METTL6 (NM_152396) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of METTL6 (NM_152396) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of METTL6 (NM_001301792) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of METTL6 (NM_001301790) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of METTL6 (NM_001301791) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack