Products

cDNA Clones (34)
Proteins (13)
RNAi (10)
Gene Expression (8)
Antibodies (1)
Jump to Filters
View as table Download
Mettl6 (NM_025907) Mouse Tagged ORF Clone
MR203828

USD 68.00

USD 149.00

In Stock

Mettl6 (Myc-DDK-tagged) - Mouse methyltransferase like 6 (Mettl6)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Methyltransferase like 6 (METTL6) Human Gene Knockout Kit (CRISPR)
KN423504

USD 1,290.00

2 Weeks

METTL6 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN423504 is the updated version of KN223504.
Mettl6 Mouse Gene Knockout Kit (CRISPR)
KN510010

USD 1,290.00

2 Weeks

Mettl6 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN510010 is the updated version of KN310010.
Mettl6 (NM_025907) Mouse Tagged ORF Clone
MG203828

USD 300.00

3 Weeks

Mettl6 (GFP-tagged) - Mouse methyltransferase like 6 (Mettl6)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Mettl6 (NM_025907) Mouse Tagged ORF Clone
MR203828L3

USD 500.00

3 Weeks

Lenti ORF clone of Mettl6 (Myc-DDK-tagged) - Mouse methyltransferase like 6 (Mettl6)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Mettl6 (NM_025907) Mouse Tagged ORF Clone
MR203828L4

USD 500.00

3 Weeks

Lenti ORF clone of Mettl6 (mGFP-tagged) - Mouse methyltransferase like 6 (Mettl6)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Methyltransferase like 6 (METTL6) (NM_152396) Human Tagged ORF Clone Lentiviral Particle
RC223504L3V

USD 820.00

5 Weeks

Lenti ORF particles, METTL6 (Myc-DDK tagged) - Human methyltransferase like 6 (METTL6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Mettl6 (NM_001007623) Rat Tagged ORF Clone
RR205034

USD 420.00

4 Weeks

Mettl6 (Myc-DDK-tagged ORF) - Rat methyltransferase like 6 (Mettl6), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Mettl6 (NM_001007623) Rat Tagged ORF Clone
RR205034L3

USD 640.00

9 Weeks

Lenti ORF clone of Mettl6 (Myc-DDK-tagged ORF) - Rat methyltransferase like 6 (Mettl6), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Mettl6 (NM_001007623) Rat Tagged ORF Clone
RR205034L4

USD 700.00

9 Weeks

Lenti ORF clone of Mettl6 (mGFP-tagged ORF) - Rat methyltransferase like 6 (Mettl6), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Mettl6 (NM_025907) Mouse Untagged Clone
MC204445

USD 210.00

In Stock

Mettl6 (untagged) - Mouse methyltransferase like 6 (Mettl6), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
Methyltransferase like 6 (METTL6) Rabbit Polyclonal Antibody
TA330974

USD 375.00

5 Days

Rabbit polyclonal Anti-METTL6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-METTL6 antibody: synthetic peptide directed towards the N terminal of human METTL6. Synthetic peptide located within the following region: QKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTML
Human Methyltransferase like 6 (METTL6) activation kit by CRISPRa
GA115160

USD 1,290.00

2 Weeks

METTL6 CRISPRa kit - CRISPR gene activation of human methyltransferase like 6

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Mettl6 activation kit by CRISPRa
GA207082

USD 1,290.00

2 Weeks

Mettl6 CRISPRa kit - CRISPR gene activation of mouse methyltransferase like 6

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
METTL6 Human qPCR Template Standard (NM_152396)
HK211884

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene METTL6

Application Plasmid of exact quantity for transcript copy number calculation
Mettl6 Mouse qPCR Template Standard (NM_025907)
MK203677

USD 330.00

5 Days

qPCR primer pairs and template standards against Mus musculus gene Mettl6

Application Plasmid of exact quantity for transcript copy number calculation
Mettl6 Mouse qPCR Primer Pair (NM_025907)
MP208126

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Mettl6

Mettl6 (NM_001007623) Rat Untagged Clone
RN205034

USD 420.00

5 Weeks

Mettl6 (untagged ORF) - Rat methyltransferase like 6 (Mettl6), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Methyltransferase like 6 (METTL6) (NM_152396) Human 3' UTR Clone
SC214297

USD 560.00

4 Weeks

3`UTR clone of methyltransferase like 6 (METTL6) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
Mettl6 Mouse siRNA Oligo Duplex (Locus ID 67011)
SR408104

USD 430.00

2 Weeks

Mettl6 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).
Methyltransferase like 6 (METTL6) (NM_152396) ICC Control Block
TB423504

USD 1,070.00

4 Weeks

Transient overexpression of METTL6 (NM_152396) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Methyltransferase like 6 (METTL6) (NM_001301792) ICC Control Block
TB436459

USD 1,070.00

4 Weeks

Transient overexpression of METTL6 (NM_001301792) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Methyltransferase like 6 (METTL6) (NM_001301790) ICC Control Block
TB436837

USD 1,070.00

4 Weeks

Transient overexpression of METTL6 (NM_001301790) in HEK293T cells paraffin embedded controls for ICC/IHC staining