Products

cDNA Clones (15)
Proteins (9)
Antibodies (3)
Jump to Filters
View as table Download
NDUFV1 (NM_007103) Human Tagged ORF Clone
RC204954

USD 420.00

In Stock

NDUFV1 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NDUFV1 (NM_007103) Human Tagged ORF Clone
RG204954

USD 460.00

In Stock

NDUFV1 (GFP-tagged) - Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NDUFV1 (NM_007103) Human Tagged ORF Clone
RC204954L3

USD 620.00

3 Weeks

Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFV1 (NM_007103) Human Tagged ORF Clone Lentiviral Particle
RC204954L3V

USD 820.00

6 Weeks

Lenti ORF particles, NDUFV1 (Myc-DDK tagged) - Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFV1 (NM_007103) Human Tagged ORF Clone
RC204954L4

USD 620.00

3 Weeks

Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFV1 (NM_007103) Human Tagged ORF Clone Lentiviral Particle
RC204954L4V

USD 820.00

6 Weeks

Lenti ORF particles, NDUFV1 (mGFP-tagged) - Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFV1 (NM_001166102) Human Tagged ORF Clone
RC228904

USD 480.00

2 Weeks

NDUFV1 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NDUFV1 (NM_001166102) Human Tagged ORF Clone
RC228904L3

USD 680.00

8 Weeks

Lenti-ORF clone of NDUFV1 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFV1 (NM_001166102) Human Tagged ORF Clone Lentiviral Particle
RC228904L3V

USD 880.00

11 Weeks

Lenti ORF particles, NDUFV1 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFV1 (NM_001166102) Human Tagged ORF Clone
RC228904L4

USD 680.00

8 Weeks

Lenti-ORF clone of NDUFV1 (mGFP-tagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFV1 (NM_001166102) Human Tagged ORF Clone Lentiviral Particle
RC228904L4V

USD 880.00

11 Weeks

Lenti ORF particles, NDUFV1 (mGFP-tagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFV1 (NM_001166102) Human Tagged ORF Clone
RG228904

USD 530.00

3 Weeks

NDUFV1 (GFP-tagged) - Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NDUFV1 (NM_007103) Human Untagged Clone
SC115721

USD 310.00

In Stock

NDUFV1 (untagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
NDUFV1 Rabbit Polyclonal Antibody
TA346612

USD 410.00

5 Days

Rabbit Polyclonal Anti-NDUFV1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDUFV1 antibody: synthetic peptide directed towards the N terminal of human NDUFV1. Synthetic peptide located within the following region: FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG
NDUFV1 (NM_007103) Human Untagged Clone
SC320461

USD 310.00

In Stock

NDUFV1 (untagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
NDUFV1 (NM_007103) Human Over-expression Lysate
LC416198

USD 121.00

In Stock

NDUFV1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NDUFV1 Rabbit Polyclonal Antibody
TA308224

USD 415.00

5 Days

Rabbit Polyclonal antibody to NDUFV1 (NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 218 and 459 of NDUFV1 (Uniprot ID#P49821)
NDUFV1 (NM_007103) Human Over-expression Lysate
LY416198

USD 396.00

5 Days

Transient overexpression lysate of NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NDUFV1 (NM_007103) Human Mass Spec Standard
PH304954

USD 2,055.00

3 Weeks

NDUFV1 MS Standard C13 and N15-labeled recombinant protein (NP_009034)

Tag C-Myc/DDK
Expression Host HEK293
NDUFV1 (NM_001166102) Human Untagged Clone
SC327539

USD 760.00

3 Weeks

NDUFV1 (untagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 1 51kDa (NDUFV1) nuclear gene encoding mitochondrial protein transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
NDUFV1 Rabbit Polyclonal Antibody
TA350221

USD 345.00

In Stock

Rabbit Polyclonal Anti-NDUFV1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NDUFV1
NDUFV1 ICC Control Block
TB404954

USD 1,070.00

4 Weeks

Transient overexpression of NDUFV1 (NM_007103) in HEK293T cells paraffin embedded controls for ICC/IHC staining

NDUFV1 ICC Control Block
TB428904

USD 1,130.00

4 Weeks

Transient overexpression of NDUFV1 (NM_001166102) in HEK293T cells paraffin embedded controls for ICC/IHC staining

NDUFV1 Cytosection
TS404954

USD 225.00

4 Weeks

Transient overexpression of NDUFV1 (NM_007103) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

NDUFV1 Cytosection
TS404954P5

USD 889.00

4 Weeks

Transient overexpression of NDUFV1 (NM_007103) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

NDUFV1 ICC Control Sections
TS428904P5

USD 889.00

4 Weeks

Transient overexpression of NDUFV1 (NM_001166102) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack