Products

cDNA Clones (30)
RNAi (13)
Proteins (10)
Gene Expression (8)
Antibodies (5)
Jump to Filters
View as table Download
NDUFV1 (NM_007103) Human Tagged ORF Clone
RC204954

USD 420.00

In Stock

NDUFV1 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Ndufv1 (NM_133666) Mouse Tagged ORF Clone
MR207415

USD 350.00

In Stock

Ndufv1 (Myc-DDK-tagged) - Mouse NADH dehydrogenase (ubiquinone) flavoprotein 1 (Ndufv1), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NDUFV1 (NM_007103) Human Tagged ORF Clone
RG204954

USD 460.00

In Stock

NDUFV1 (GFP-tagged) - Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NDUFV1 Human Gene Knockout Kit (CRISPR)
KN404954

USD 1,290.00

2 Weeks

NDUFV1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN404954 is the updated version of KN204954.
Ndufv1 Mouse Gene Knockout Kit (CRISPR)
KN510862

USD 1,290.00

2 Weeks

Ndufv1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN510862 is the updated version of KN310862.
Ndufv1 (NM_133666) Mouse Tagged ORF Clone
MG207415

USD 390.00

3 Weeks

Ndufv1 (GFP-tagged) - Mouse NADH dehydrogenase (ubiquinone) flavoprotein 1 (Ndufv1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ndufv1 (NM_133666) Mouse Tagged ORF Clone
MR207415L3

USD 550.00

3 Weeks

Lenti ORF clone of Ndufv1 (Myc-DDK-tagged) - Mouse NADH dehydrogenase (ubiquinone) flavoprotein 1 (Ndufv1), nuclear gene encoding mitochondrial protein

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ndufv1 (NM_133666) Mouse Tagged ORF Clone Lentiviral Particle
MR207415L3V

USD 750.00

6 Weeks

Lenti ORF particles, Ndufv1 (Myc-DDK-tagged) - Mouse NADH dehydrogenase (ubiquinone) flavoprotein 1 (Ndufv1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ndufv1 (NM_133666) Mouse Tagged ORF Clone
MR207415L4

USD 550.00

3 Weeks

Lenti ORF clone of Ndufv1 (mGFP-tagged) - Mouse NADH dehydrogenase (ubiquinone) flavoprotein 1 (Ndufv1), nuclear gene encoding mitochondrial protein

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ndufv1 (NM_133666) Mouse Tagged ORF Clone Lentiviral Particle
MR207415L4V

USD 750.00

6 Weeks

Lenti ORF particles, Ndufv1 (GFP-tagged) - Mouse NADH dehydrogenase (ubiquinone) flavoprotein 1 (Ndufv1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFV1 (NM_007103) Human Tagged ORF Clone
RC204954L3

USD 620.00

3 Weeks

Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFV1 (NM_007103) Human Tagged ORF Clone Lentiviral Particle
RC204954L3V

USD 820.00

6 Weeks

Lenti ORF particles, NDUFV1 (Myc-DDK tagged) - Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFV1 (NM_007103) Human Tagged ORF Clone
RC204954L4

USD 620.00

3 Weeks

Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFV1 (NM_007103) Human Tagged ORF Clone Lentiviral Particle
RC204954L4V

USD 820.00

6 Weeks

Lenti ORF particles, NDUFV1 (mGFP-tagged) - Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFV1 (NM_001166102) Human Tagged ORF Clone
RC228904

USD 480.00

2 Weeks

NDUFV1 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NDUFV1 (NM_001166102) Human Tagged ORF Clone
RC228904L3

USD 680.00

8 Weeks

Lenti-ORF clone of NDUFV1 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFV1 (NM_001166102) Human Tagged ORF Clone Lentiviral Particle
RC228904L3V

USD 880.00

11 Weeks

Lenti ORF particles, NDUFV1 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFV1 (NM_001166102) Human Tagged ORF Clone
RC228904L4

USD 680.00

8 Weeks

Lenti-ORF clone of NDUFV1 (mGFP-tagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFV1 (NM_001166102) Human Tagged ORF Clone Lentiviral Particle
RC228904L4V

USD 880.00

11 Weeks

Lenti ORF particles, NDUFV1 (mGFP-tagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFV1 (NM_001166102) Human Tagged ORF Clone
RG228904

USD 530.00

3 Weeks

NDUFV1 (GFP-tagged) - Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ndufv1 (NM_001006972) Rat Tagged ORF Clone
RR204770

USD 630.00

4 Weeks

Ndufv1 (Myc-DDK-tagged ORF) - Rat NADH dehydrogenase (ubiquinone) flavoprotein 1 (Ndufv1), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Ndufv1 (NM_001006972) Rat Tagged ORF Clone
RR204770L3

USD 820.00

9 Weeks

Lenti ORF clone of Ndufv1 (Myc-DDK-tagged ORF) - Rat NADH dehydrogenase (ubiquinone) flavoprotein 1 (Ndufv1), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ndufv1 (NM_001006972) Rat Tagged ORF Clone Lentiviral Particle
RR204770L3V

USD 1,050.00

13 Weeks

Lenti ORF particles, Ndufv1 (Myc-DDK-tagged ORF) - Rat NADH dehydrogenase (ubiquinone) flavoprotein 1 (Ndufv1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ndufv1 (NM_001006972) Rat Tagged ORF Clone
RR204770L4

USD 910.00

9 Weeks

Lenti ORF clone of Ndufv1 (mGFP-tagged ORF) - Rat NADH dehydrogenase (ubiquinone) flavoprotein 1 (Ndufv1), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ndufv1 (NM_001006972) Rat Tagged ORF Clone Lentiviral Particle
RR204770L4V

USD 1,170.00

13 Weeks

Lenti ORF particles, Ndufv1 (GFP-tagged ORF) - Rat NADH dehydrogenase (ubiquinone) flavoprotein 1 (Ndufv1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NDUFV1 (NM_007103) Human Untagged Clone
SC115721

USD 310.00

In Stock

NDUFV1 (untagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
NDUFV1 Rabbit Polyclonal Antibody
TA346612

USD 410.00

5 Days

Rabbit Polyclonal Anti-NDUFV1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDUFV1 antibody: synthetic peptide directed towards the N terminal of human NDUFV1. Synthetic peptide located within the following region: FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG
Ndufv1 Mouse siRNA Oligo Duplex (Locus ID 17995)
SR415063

USD 430.00

2 Weeks

Ndufv1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Ndufv1 Mouse shRNA Plasmid (Locus ID 17995)
TG501448

USD 715.00

In Stock

Ndufv1 - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
Ndufv1 (NM_133666) Mouse Untagged Clone
MC202923

USD 210.00

In Stock

Ndufv1 (untagged) - Mouse NADH dehydrogenase (ubiquinone) flavoprotein 1 (Ndufv1), nuclear gene encoding mitochondrial protein, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
NDUFV1 (NM_007103) Human Untagged Clone
SC320461

USD 310.00

In Stock

NDUFV1 (untagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Ndufv1 Mouse shRNA Plasmid (Locus ID 17995)
TL501448

USD 815.00

In Stock

Ndufv1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
NDUFV1 (NM_007103) Human Over-expression Lysate
LC416198

USD 121.00

In Stock

NDUFV1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NDUFV1 Rabbit Polyclonal Antibody
TA308224

USD 415.00

5 Days

Rabbit Polyclonal antibody to NDUFV1 (NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 218 and 459 of NDUFV1 (Uniprot ID#P49821)
NDUFV1 (NM_007103) Human Over-expression Lysate
LY416198

USD 396.00

5 Days

Transient overexpression lysate of NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa (NDUFV1), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Human NDUFV1 activation kit by CRISPRa
GA103151

USD 1,290.00

2 Weeks

NDUFV1 CRISPRa kit - CRISPR gene activation of human NADH:ubiquinone oxidoreductase core subunit V1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Ndufv1 activation kit by CRISPRa
GA202852

USD 1,290.00

2 Weeks

Ndufv1 CRISPRa kit - CRISPR gene activation of mouse NADH:ubiquinone oxidoreductase core subunit V1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
NDUFV1 Human qPCR Template Standard (NM_007103)
HK205081

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene NDUFV1

Application Plasmid of exact quantity for transcript copy number calculation
NDUFV1 Human qPCR Primer Pair (NM_007103)
HP209895

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene NDUFV1

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Ndufv1 Mouse qPCR Template Standard (NM_133666)
MK202375

USD 330.00

5 Days

qPCR primer pairs and template standards against Mus musculus gene Ndufv1

Application Plasmid of exact quantity for transcript copy number calculation
Ndufv1 Mouse qPCR Primer Pair (NM_133666)
MP208682

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Ndufv1

NDUFV1 (NM_007103) Human Mass Spec Standard
PH304954

USD 2,055.00

3 Weeks

NDUFV1 MS Standard C13 and N15-labeled recombinant protein (NP_009034)

Tag C-Myc/DDK
Expression Host HEK293
Ndufv1 (NM_001006972) Rat Untagged Clone
RN204770

USD 630.00

5 Weeks

Ndufv1 (untagged ORF) - Rat NADH dehydrogenase (ubiquinone) flavoprotein 1 (Ndufv1), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
NDUFV1 (NM_001166102) Human 3' UTR Clone
SC200396

USD 560.00

4 Weeks

3`UTR clone of NADH dehydrogenase (ubiquinone) flavoprotein 1 51kDa (NDUFV1) nuclear gene encoding mitochondrial protein transcript variant 2 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
NDUFV1 (NM_007103) Human 3' UTR Clone
SC200397

USD 560.00

4 Weeks

3`UTR clone of NADH dehydrogenase (ubiquinone) flavoprotein 1 51kDa (NDUFV1) nuclear gene encoding mitochondrial protein transcript variant 1 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
NDUFV1 (NM_001166102) Human Untagged Clone
SC327539

USD 760.00

3 Weeks

NDUFV1 (untagged)-Human NADH dehydrogenase (ubiquinone) flavoprotein 1 51kDa (NDUFV1) nuclear gene encoding mitochondrial protein transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
NDUFV1 Human siRNA Oligo Duplex (Locus ID 4723)
SR303120

USD 430.00

2 Weeks

NDUFV1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Ndufv1 Rat siRNA Oligo Duplex (Locus ID 293655)
SR504484

USD 430.00

2 Weeks

Ndufv1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

NDUFV1 Rabbit Polyclonal Antibody
TA350221

USD 345.00

In Stock

Rabbit Polyclonal Anti-NDUFV1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NDUFV1