Products

cDNA Clones (7)
Proteins (5)
Antibodies (4)
Jump to Filters
View as table Download
RNA Polymerase II p14.5 (POLR2I) (NM_006233) Human Tagged ORF Clone
RC209776

USD 98.00

USD 390.00

In Stock

POLR2I (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa (POLR2I)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RNA Polymerase II p14.5 (POLR2I) (NM_006233) Human Tagged ORF Clone Lentiviral Particle
RC209776L3V

USD 820.00

6 Weeks

Lenti ORF particles, POLR2I (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa (POLR2I), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RNA Polymerase II p14.5 (POLR2I) (NM_006233) Human Tagged ORF Clone Lentiviral Particle
RC209776L4V

USD 820.00

6 Weeks

Lenti ORF particles, POLR2I (mGFP-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa (POLR2I), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RNA Polymerase II p14.5 (POLR2I) (NM_006233) Human Tagged ORF Clone
RG209776

USD 460.00

3 Weeks

POLR2I (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa (POLR2I)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RNA Polymerase II p14.5 (POLR2I) Rabbit Polyclonal Antibody
TA327205

USD 275.00

3 Weeks

POLR2I Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human POLR2I
RNA Polymerase II p14.5 (POLR2I) (NM_006233) Human Untagged Clone
SC116236

USD 420.00

In Stock

POLR2I (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa (POLR2I)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
RNA Polymerase II p14.5 (POLR2I) Rabbit Polyclonal Antibody
TA322526

USD 345.00

4 Weeks

Anti-POLR2I Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
RNA Polymerase II p14.5 (POLR2I) Rabbit Polyclonal Antibody
TA339121

USD 375.00

5 Days

Rabbit Polyclonal Anti-POLR2I Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR2I antibody: synthetic peptide directed towards the N terminal of human POLR2I. Synthetic peptide located within the following region: ACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPRTEDHPCQ
RNA Polymerase II p14.5 (POLR2I) Rabbit Polyclonal Antibody
TA343591

USD 375.00

5 Days

Rabbit Polyclonal Anti-POLR2I Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR2I antibody: synthetic peptide directed towards the N terminal of human POLR2I. Synthetic peptide located within the following region: EPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNS
POLR2I (1-125, His-tag) Human Protein
AR50652PU-N

USD 1,105.00

2 Weeks

POLR2I (1-125, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
POLR2I (1-125, His-tag) Human Protein
AR50652PU-S

USD 415.00

2 Weeks

POLR2I (1-125, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
RNA Polymerase II p14.5 (POLR2I) ICC Control Block
TB409776

USD 1,040.00

4 Weeks

Transient overexpression of POLR2I (NM_006233) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RNA Polymerase II p14.5 (POLR2I) Cytosection
TS409776

USD 225.00

4 Weeks

Transient overexpression of POLR2I (NM_006233) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

RNA Polymerase II p14.5 (POLR2I) Cytosection
TS409776P5

USD 889.00

4 Weeks

Transient overexpression of POLR2I (NM_006233) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack