Germany
Japan
United Kingdom
China
Polr2i (Myc-DDK-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide I (Polr2i)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadUSD 98.00
USD 390.00
In Stock
POLR2I (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa (POLR2I)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Polr2i - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513605 is the updated version of KN313605.
Polr2i (GFP-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide I (Polr2i)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Polr2i (Myc-DDK-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide I (Polr2i)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Polr2i (Myc-DDK-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide I (Polr2i), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Polr2i (mGFP-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide I (Polr2i)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Polr2i (GFP-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide I (Polr2i), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of POLR2I (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa (POLR2I)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, POLR2I (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa (POLR2I), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of POLR2I (mGFP-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa (POLR2I)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, POLR2I (mGFP-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa (POLR2I), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
POLR2I (GFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa (POLR2I)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Polr2i (Myc-DDK-tagged ORF) - Rat polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa (Polr2i), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Polr2i (Myc-DDK-tagged ORF) - Rat polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa (Polr2i), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Polr2i (Myc-DDK-tagged ORF) - Rat polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa (Polr2i), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Polr2i (mGFP-tagged ORF) - Rat polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa (Polr2i), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Polr2i (GFP-tagged ORF) - Rat polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa (Polr2i), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
POLR2I Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human POLR2I |
POLR2I (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa (POLR2I)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Anti-POLR2I Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-POLR2I Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR2I antibody: synthetic peptide directed towards the N terminal of human POLR2I. Synthetic peptide located within the following region: ACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPRTEDHPCQ |
Rabbit Polyclonal Anti-POLR2I Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR2I antibody: synthetic peptide directed towards the N terminal of human POLR2I. Synthetic peptide located within the following region: EPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNS |
POLR2I (1-125, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
POLR2I (1-125, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
POLR2I CRISPRa kit - CRISPR gene activation of human RNA polymerase II subunit I
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
USD 440.00
5 Days
qPCR primer pairs and template standards against Homo sapiens gene POLR2I
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene POLR2I
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Polr2i (untagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide I (Polr2i), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Polr2i
AAV ORF Particles, serotype AAV-2, Polr2i (Myc-DDK-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide I (Polr2i), 250ul, >10^13 TU/mL
- AAV ORF®
-
Polr2i (untagged ORF) - Rat polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa (Polr2i), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of polymerase (RNA) II (DNA directed) polypeptide I 14.5kDa (POLR2I) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
POLR2I (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Polr2i (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Polr2i (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression of POLR2I (NM_006233) in HEK293T cells paraffin embedded controls for ICC/IHC staining
POLR2I - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
USD 1,395.00
5 Weeks
POLR2I - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Polr2i - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Polr2i - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Polr2i - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Polr2i - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
POLR2I - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Polr2i - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Polr2i - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of POLR2I (NM_006233) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of POLR2I (NM_006233) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- POLR2I