Products

cDNA Clones (33)
Proteins (22)
Antibodies (5)
Jump to Filters
View as table Download
CACNB4 (NM_000726) Human Tagged ORF Clone
RC210440

USD 420.00

In Stock

CACNB4 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CACNB4 (NM_001005747) Human Tagged ORF Clone
RC221164

USD 450.00

In Stock

CACNB4 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CACNB4 (NM_001005746) Human Tagged ORF Clone
RC213262

USD 460.00

In Stock

CACNB4 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CACNB4 (NM_001145798) Human Tagged ORF Clone
RC227880

USD 430.00

In Stock

CACNB4 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CACNB4 (NM_000726) Human Tagged ORF Clone Lentiviral Particle
RC210440L1V

USD 820.00

3 Weeks

Lenti ORF particles, CACNB4 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CACNB4 (NM_000726) Human Tagged ORF Clone Lentiviral Particle
RC210440L2V

USD 820.00

6 Weeks

Lenti ORF particles, CACNB4 (mGFP-tagged) - Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CACNB4 (NM_000726) Human Tagged ORF Clone
RG210440

USD 460.00

In Stock

CACNB4 (GFP-tagged) - Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNB4 (NM_000726) Human Tagged ORF Clone
RC210440L3

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNB4 (NM_000726) Human Tagged ORF Clone Lentiviral Particle
RC210440L3V

USD 820.00

5 Weeks

Lenti ORF particles, CACNB4 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNB4 (NM_000726) Human Tagged ORF Clone
RC210440L4

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNB4 (NM_000726) Human Tagged ORF Clone Lentiviral Particle
RC210440L4V

USD 820.00

7 Weeks

Lenti ORF particles, CACNB4 (mGFP-tagged) - Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNB4 (NM_001005746) Human Tagged ORF Clone
RC213262L3

USD 660.00

3 Weeks

Lenti-ORF clone of CACNB4 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNB4 (NM_001005746) Human Tagged ORF Clone Lentiviral Particle
RC213262L3V

USD 860.00

6 Weeks

Lenti ORF particles, CACNB4 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNB4 (NM_001005746) Human Tagged ORF Clone
RC213262L4

USD 660.00

3 Weeks

Lenti-ORF clone of CACNB4 (mGFP-tagged)-Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNB4 (NM_001005746) Human Tagged ORF Clone Lentiviral Particle
RC213262L4V

USD 860.00

6 Weeks

Lenti ORF particles, CACNB4 (mGFP-tagged)-Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNB4 (NM_001005747) Human Tagged ORF Clone
RC221164L3

USD 650.00

3 Weeks

Lenti ORF clone of Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNB4 (NM_001005747) Human Tagged ORF Clone Lentiviral Particle
RC221164L3V

USD 850.00

6 Weeks

Lenti ORF particles, CACNB4 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNB4 (NM_001005747) Human Tagged ORF Clone
RC221164L4

USD 650.00

3 Weeks

Lenti ORF clone of Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNB4 (NM_001005747) Human Tagged ORF Clone Lentiviral Particle
RC221164L4V

USD 850.00

6 Weeks

Lenti ORF particles, CACNB4 (mGFP-tagged) - Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNB4 (NM_001145798) Human Tagged ORF Clone
RC227880L3

USD 630.00

3 Weeks

Lenti-ORF clone of CACNB4 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNB4 (NM_001145798) Human Tagged ORF Clone Lentiviral Particle
RC227880L3V

USD 830.00

6 Weeks

Lenti ORF particles, CACNB4 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNB4 (NM_001145798) Human Tagged ORF Clone
RC227880L4

USD 630.00

3 Weeks

Lenti-ORF clone of CACNB4 (mGFP-tagged)-Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNB4 (NM_001145798) Human Tagged ORF Clone Lentiviral Particle
RC227880L4V

USD 830.00

6 Weeks

Lenti ORF particles, CACNB4 (mGFP-tagged)-Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNB4 (NM_001005746) Human Tagged ORF Clone
RG213262

USD 510.00

3 Weeks

CACNB4 (GFP-tagged) - Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNB4 (NM_001005747) Human Tagged ORF Clone
RG221164

USD 500.00

3 Weeks

CACNB4 (GFP-tagged) - Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNB4 (NM_001145798) Human Tagged ORF Clone
RG227880

USD 470.00

3 Weeks

CACNB4 (GFP-tagged) - Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNB4 (NM_000726) Human Tagged ORF Clone
RC210440L1

USD 768.00

In Stock

Lenti ORF clone of Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CACNB4 (NM_000726) Human Untagged Clone
SC311158

USD 760.00

In Stock

CACNB4 (untagged)-Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CACNB4 (NM_000726) Human Tagged ORF Clone
RC210440L2

USD 620.00

3 Weeks

Lenti ORF clone of Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CACNB4 (NM_001005747) Human Untagged Clone
SC301026

USD 820.00

In Stock

CACNB4 (untagged)-Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CACNB4 (NM_000726) Human Over-expression Lysate
LC400240

USD 121.00

In Stock

CACNB4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
CACNB4 (NM_001005746) Human Over-expression Lysate
LC423646

USD 187.00

In Stock

CACNB4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CACNB4 (NM_000726) Human Over-expression Lysate
LY400240

USD 396.00

5 Days

Transient overexpression lysate of calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CACNB4 (NM_001005746) Human Over-expression Lysate
LY423646

USD 605.00

In Stock

Transient overexpression lysate of calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CACNB4 (NM_001005747) Human Over-expression Lysate
LY423647

USD 605.00

In Stock

Transient overexpression lysate of calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CACNB4 (NM_001145798) Human Over-expression Lysate
LY429012

USD 396.00

In Stock

Transient overexpression lysate of calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CACNB4 (NM_000726) Human Mass Spec Standard
PH310440

USD 2,055.00

3 Weeks

CACNB4 MS Standard C13 and N15-labeled recombinant protein (NP_000717)

Tag C-Myc/DDK
Expression Host HEK293
CACNB4 Goat Polyclonal Antibody
TA302437

USD 375.00

5 Days

Goat Polyclonal Antibody against CACNB4 (C terminus)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CSPGGYSHDSRHRL, from the C Terminus of the protein sequence according to NP_001005747.1; NP_000717.2; NP_001005746.1.
CACNB4 Goat Polyclonal Antibody
TA302438

USD 375.00

5 Days

Goat Polyclonal Antibody against CACNB4 (internal)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DYPDSYQDTYKPH, from the internal region (near the C Terminus) of the protein sequence according to NP_001005747.1; NP_000717.2; NP_001005746.1.
CACNB4 Mouse Monoclonal Antibody [Clone ID: S10-7]
TA326345

USD 410.00

5 Days

Mouse monoclonal CaVbeta4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CACNB4 Rabbit Polyclonal Antibody
TA338347

USD 375.00

5 Days

Rabbit Polyclonal Anti-CACNB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB4 antibody: synthetic peptide directed towards the C terminal of human CACNB4. Synthetic peptide located within the following region: LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS
CACNB4 Rabbit Polyclonal Antibody
TA341725

USD 375.00

5 Days

Rabbit Polyclonal Anti-CACNB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB4 antibody: synthetic peptide directed towards the middle region of human CACNB4. Synthetic peptide located within the following region: FDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRISSLAEVQSEIERIF
CACNB4 (NM_001005747) Human Over-expression Lysate
LC423647

USD 187.00

2 Weeks

CACNB4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CACNB4 (NM_001145798) Human Over-expression Lysate
LC429012

USD 121.00

2 Weeks

CACNB4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CACNB4 (NM_001005746) Human Untagged Clone
SC301025

USD 840.00

3 Weeks

CACNB4 (untagged)-Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CACNB4 (AY054985) Human Untagged Clone
SC313678

USD 1,410.00

5 Weeks

(untagged)-Human voltage-dependent calcium channel beta-4a subunit

Vector pCMV6 series
Tag Tag Free
CACNB4 (NM_001145798) Human Untagged Clone
SC326577

USD 770.00

3 Weeks

CACNB4 (untagged)-Human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 4, mRNA

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CACNB4 ICC Control Block
TB410440

USD 1,070.00

4 Weeks

Transient overexpression of CACNB4 (NM_000726) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CACNB4 ICC Control Block
TB413262

USD 1,110.00

4 Weeks

Transient overexpression of CACNB4 (NM_001005746) in HEK293T cells paraffin embedded controls for ICC/IHC staining