Products

View as table Download

PRKAA2 (Myc-DDK-tagged)-Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PRKAA2 (untagged)-Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

PRKAA2 (GFP-tagged) - Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PRKAA2 (Myc-DDK tagged) - Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PRKAA2 (mGFP-tagged) - Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-PRKAA2 Antibody - middle region

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKAA2 antibody: synthetic peptide directed towards the middle region of human PRKAA2. Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP

Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646)

AMPK alpha 2 (PRKAA2) (Center)/(Thr172) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 145-173 amino acids from the Central region of human PRKAA2 (Thr172)

PRKAA2 (untagged)-Kinase deficient mutant (K45M) of Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit anti-PRKAA2 (AMPK1/AMPK2, Phospho-Ser485/Ser491) polyclonal antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanAMPK1/AMPK2 around the phosphorylation site of serine 485/491 (S-G- SP-V-S).
Modifications Phospho-specific

PRKAA2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Goat Anti-PRKAA2 Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CPLDALNTTKP, from the internal region of the protein sequence according to NP_006243.2.

Goat Anti-PRKAA2, Biotinylated Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CPLDALNTTKP., from the internal region of the protein sequence according to NP_006243.2.

Anti-PRKAA2 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 16-268 amino acids of human protein kinase, AMP-activated, alpha 2 catalytic subunit

Anti-PRKAA2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 16-268 amino acids of human protein kinase, AMP-activated, alpha 2 catalytic subunit

Transient overexpression of PRKAA2 (NM_006252) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of PRKAA2 (NM_006252) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of PRKAA2 (NM_006252) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack