SGCG (Myc-DDK-tagged)-Human sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SGCG (Myc-DDK-tagged)-Human sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
SGCG (GFP-tagged) - Human sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, SGCG (Myc-DDK tagged) - Human sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, SGCG (mGFP-tagged) - Human sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
SGCG HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal SGCG Antibody (Center)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SGCG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 145-172 amino acids from the Central region of human SGCG. |
Rabbit Polyclonal Anti-SGCG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SGCG antibody: synthetic peptide directed towards the middle region of human SGCG. Synthetic peptide located within the following region: FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS |
SGCG MS Standard C13 and N15-labeled recombinant protein (NP_000222)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
SGCG (untagged)-Human sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of SGCG (NM_000231) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SGCG (NM_000231) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SGCG (NM_000231) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack