Products

cDNA Clones (21)
Proteins (13)
Antibodies (2)
Jump to Filters
View as table Download
MNK2 (MKNK2) (NM_199054) Human Tagged ORF Clone
RC216704

USD 430.00

In Stock

MKNK2 (Myc-DDK-tagged)-Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
MNK2 (MKNK2) (NM_017572) Human Tagged ORF Clone
RC210081

USD 420.00

In Stock

MKNK2 (Myc-DDK-tagged)-Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
MNK2 (MKNK2) (NM_017572) Human Tagged ORF Clone Lentiviral Particle
RC210081L1V

USD 820.00

3 Weeks

Lenti ORF particles, MKNK2 (Myc-DDK tagged) - Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
MNK2 (MKNK2) (NM_017572) Human Tagged ORF Clone Lentiviral Particle
RC210081L2V

USD 820.00

3 Weeks

Lenti ORF particles, MKNK2 (mGFP-tagged) - Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
MNK2 (MKNK2) (NM_199054) Human Tagged ORF Clone Lentiviral Particle
RC216704L1V

USD 830.00

3 Weeks

Lenti ORF particles, MKNK2 (Myc-DDK tagged) - Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
MNK2 (MKNK2) (NM_199054) Human Tagged ORF Clone Lentiviral Particle
RC216704L2V

USD 830.00

6 Weeks

Lenti ORF particles, MKNK2 (mGFP-tagged) - Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
MNK2 (MKNK2) (NM_017572) Human Tagged ORF Clone
RG210081

USD 460.00

In Stock

MKNK2 (GFP-tagged) - Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MNK2 (MKNK2) (NM_199054) Human Tagged ORF Clone
RG216704

USD 470.00

In Stock

MKNK2 (GFP-tagged) - Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MNK2 (MKNK2) (NM_017572) Human Tagged ORF Clone
RC210081L3

USD 620.00

3 Weeks

Lenti ORF clone of Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MNK2 (MKNK2) (NM_017572) Human Tagged ORF Clone Lentiviral Particle
RC210081L3V

USD 820.00

5 Weeks

Lenti ORF particles, MKNK2 (Myc-DDK tagged) - Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MNK2 (MKNK2) (NM_017572) Human Tagged ORF Clone
RC210081L4

USD 620.00

3 Weeks

Lenti ORF clone of Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MNK2 (MKNK2) (NM_017572) Human Tagged ORF Clone Lentiviral Particle
RC210081L4V

USD 820.00

5 Weeks

Lenti ORF particles, MKNK2 (mGFP-tagged) - Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MNK2 (MKNK2) (NM_199054) Human Tagged ORF Clone
RC216704L3

USD 630.00

3 Weeks

Lenti ORF clone of Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MNK2 (MKNK2) (NM_199054) Human Tagged ORF Clone Lentiviral Particle
RC216704L3V

USD 830.00

5 Weeks

Lenti ORF particles, MKNK2 (Myc-DDK tagged) - Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MNK2 (MKNK2) (NM_199054) Human Tagged ORF Clone
RC216704L4

USD 630.00

3 Weeks

Lenti ORF clone of Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MNK2 (MKNK2) (NM_199054) Human Tagged ORF Clone Lentiviral Particle
RC216704L4V

USD 830.00

7 Weeks

Lenti ORF particles, MKNK2 (mGFP-tagged) - Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MNK2 (MKNK2) (NM_017572) Human Over-expression Lysate
LY413712

USD 396.00

In Stock

Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MNK2 (MKNK2) (NM_017572) Human Tagged ORF Clone
RC210081L1

USD 768.00

In Stock

Lenti ORF clone of Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
MNK2 (MKNK2) (NM_199054) Human Untagged Clone
SC307857

USD 780.00

In Stock

MKNK2 (untagged)-Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 2

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
MNK2 (MKNK2) Rabbit Polyclonal Antibody
TA313959

USD 345.00

In Stock

Rabbit polyclonal anti-MNK2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human MNK2.
MNK2 (MKNK2) (NM_017572) Human Recombinant Protein
TP760279

USD 215.00

In Stock

Recombinant protein of human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
MNK2 (MKNK2) (NM_199054) Human Tagged ORF Clone
RC216704L2

USD 630.00

3 Weeks

Lenti ORF clone of Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
MNK2 (MKNK2) (NM_017572) Human Over-expression Lysate
LC413712

USD 121.00

In Stock

MKNK2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MNK2 (MKNK2) (NM_199054) Human Over-expression Lysate
LY404728

USD 605.00

5 Days

Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MNK2 (MKNK2) Rabbit Polyclonal Antibody
TA333339

USD 375.00

5 Days

Rabbit Polyclonal Anti-MKNK2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MKNK2 Antibody: synthetic peptide directed towards the N terminal of human MKNK2. Synthetic peptide located within the following region: SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL
MNK2 (MKNK2) (NM_199054) Human Over-expression Lysate
LC404728

USD 187.00

2 Weeks

MKNK2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MNK2 (MKNK2) (NM_199054) Human Mass Spec Standard
PH316704

USD 2,055.00

3 Weeks

MKNK2 MS Standard C13 and N15-labeled recombinant protein (NP_951009)

Tag C-Myc/DDK
Expression Host HEK293
MNK2 (MKNK2) (AK092536) Human Untagged Clone
SC312147

USD 960.00

3 Weeks

(untagged)-Human cDNA FLJ35217 fis, clone PROST2000284, highly similar to Human MAP kinase-interacting kinase 2a mRNA

Vector pCMV6 series
Tag Tag Free
MNK2 (MKNK2) (NM_017572) Human Untagged Clone
SC315549

USD 760.00

4 Weeks

MKNK2 (untagged)-Human MAP kinase interacting serine/threonine kinase 2 (MKNK2), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
MNK2 (MKNK2) (NM_017572) ICC Control Block
TB410081

USD 1,070.00

4 Weeks

Transient overexpression of MKNK2 (NM_017572) in HEK293T cells paraffin embedded controls for ICC/IHC staining

MNK2 (MKNK2) (NM_199054) ICC Control Block
TB416704

USD 1,080.00

4 Weeks

Transient overexpression of MKNK2 (NM_199054) in HEK293T cells paraffin embedded controls for ICC/IHC staining

MNK2 (MKNK2) Cytosection
TS410081

USD 225.00

4 Weeks

Transient overexpression of MKNK2 (NM_017572) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

MNK2 (MKNK2) Cytosection
TS410081P5

USD 889.00

4 Weeks

Transient overexpression of MKNK2 (NM_017572) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

MNK2 (MKNK2) Cytosection
TS416704

USD 225.00

4 Weeks

Transient overexpression of MKNK2 (NM_199054) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

MNK2 (MKNK2) Cytosection
TS416704P5

USD 889.00

4 Weeks

Transient overexpression of MKNK2 (NM_199054) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack