Germany
Japan
United Kingdom
China
PRKAA2 (Myc-DDK-tagged)-Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
PRKAA2 (untagged)-Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PRKAA2 (GFP-tagged) - Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
3 Weeks
Lenti ORF particles, PRKAA2 (Myc-DDK tagged) - Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, PRKAA2 (mGFP-tagged) - Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, PRKAA2 (Myc-DDK tagged) - Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
3 Weeks
Lenti ORF particles, PRKAA2 (mGFP-tagged) - Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-PRKAA2 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKAA2 antibody: synthetic peptide directed towards the middle region of human PRKAA2. Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP |
Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646) |
PRKAA2 (untagged)-Kinase deficient mutant (K45M) of Human protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit anti-PRKAA2 (AMPK1/AMPK2, Phospho-Ser485/Ser491) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanAMPK1/AMPK2 around the phosphorylation site of serine 485/491 (S-G- SP-V-S). |
| Modifications | Phospho-specific |
PRKAA2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of protein kinase, AMP-activated, alpha 2 catalytic subunit (PRKAA2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Goat Anti-PRKAA2, Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CPLDALNTTKP., from the internal region of the protein sequence according to NP_006243.2. |
Anti-PRKAA2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 16-268 amino acids of human protein kinase, AMP-activated, alpha 2 catalytic subunit |
Anti-PRKAA2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 16-268 amino acids of human protein kinase, AMP-activated, alpha 2 catalytic subunit |
Transient overexpression of PRKAA2 (NM_006252) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PRKAA2 (NM_006252) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PRKAA2 (NM_006252) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PRKAA2
Pathways
- Insulin signaling pathway