Products

cDNA Clones (11)
Antibodies (3)
Proteins (3)
Jump to Filters
View as table Download
CLDN16 (NM_006580) Human Tagged ORF Clone
RC210216

USD 420.00

In Stock

CLDN16 (Myc-DDK-tagged)-Human claudin 16 (CLDN16)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CLDN16 (NM_006580) Human Tagged ORF Clone
RG210216

USD 460.00

In Stock

CLDN16 (GFP-tagged) - Human claudin 16 (CLDN16)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CLDN16 (NM_006580) Human Tagged ORF Clone
RC210216L3

USD 620.00

3 Weeks

Lenti ORF clone of Human claudin 16 (CLDN16), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CLDN16 (NM_006580) Human Tagged ORF Clone
RC210216L4

USD 620.00

In Stock

Lenti ORF clone of Human claudin 16 (CLDN16), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CLDN16 (N-term) Rabbit Polyclonal Antibody
AP50943PU-N

USD 450.00

2 Weeks

CLDN16 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 13-41 amino acids from the N-terminal region of human CLDN16
CLDN16 (NM_006580) Human Tagged ORF Clone
RC210216L2

USD 620.00

3 Weeks

Lenti ORF clone of Human claudin 16 (CLDN16), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CLDN16 (NM_006580) Human Untagged Clone
SC303793

USD 660.00

In Stock

CLDN16 (untagged)-Human claudin 16 (CLDN16)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CLDN16 Rabbit Polyclonal Antibody
TA334204

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLDN16 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN16 antibody: synthetic peptide directed towards the C terminal of human CLDN16. Synthetic peptide located within the following region: FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA
CLDN16 Rabbit Polyclonal Antibody
TA334205

USD 310.00

5 Days

Rabbit Polyclonal Anti-CLDN16 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN16 antibody: synthetic peptide directed towards the C terminal of human CLDN16. Synthetic peptide located within the following region: FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA
CLDN16 (NM_006580) ICC Control Block
TB410216

USD 1,070.00

4 Weeks

Transient overexpression of CLDN16 (NM_006580) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CLDN16 Cytosection
TS410216

USD 225.00

4 Weeks

Transient overexpression of CLDN16 (NM_006580) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CLDN16 Cytosection
TS410216P5

USD 889.00

4 Weeks

Transient overexpression of CLDN16 (NM_006580) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack