RASSF5 (Myc-DDK-tagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RASSF5 (Myc-DDK-tagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RASSF5 (Myc-DDK-tagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RASSF5 (GFP-tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, RASSF5 (Myc-DDK tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, RASSF5 (mGFP-tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
3 Weeks
Lenti ORF particles, RASSF5 (Myc-DDK tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, RASSF5 (mGFP-tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
RASSF5 (Myc-DDK-tagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RASSF5 (GFP-tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, RASSF5 (Myc-DDK tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, RASSF5 (mGFP-tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, RASSF5 (Myc-DDK tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, RASSF5 (mGFP-tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of RASSF5 (Myc-DDK-tagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, RASSF5 (Myc-DDK-tagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of RASSF5 (mGFP-tagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, RASSF5 (mGFP-tagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
RASSF5 (GFP-tagged) - Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RASSF5 (untagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
RASSF5 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal NORE1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Residues 313-329 [DNPQKFALFKRIHKDGQ] of the NORE1 protein. This sequence is located in the RA domain of NORE1. |
Rabbit Polyclonal Anti-RASSF5 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Rassf5 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rassf5. Synthetic peptide located within the following region: SFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQK |
Carrier-free (BSA/glycerol-free) RASSF5 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RASSF5 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RASSF5 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RASSF5 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
RASSF5 MS Standard C13 and N15-labeled recombinant protein (NP_872606)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
RASSF5 (untagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 3
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
RASSF5 (untagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
RASSF5 (untagged)-Human Ras association (RalGDS/AF-6) domain family member 5 (RASSF5), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
RASSF5 mouse monoclonal antibody,clone 1C6, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
RASSF5 mouse monoclonal antibody,clone 1C6, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
RASSF5 mouse monoclonal antibody, clone 1A11, Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
RASSF5 mouse monoclonal antibody, clone 1A11, HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1H2 (formerly 1H2), Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |