Products

cDNA Clones (10)
Proteins (7)
Antibodies (4)
Jump to Filters
View as table Download
Cytochrome p450 2C19 (CYP2C19) (NM_000769) Human Recombinant Protein
TP311377

USD 867.00

In Stock

Recombinant protein of human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19)

Tag C-Myc/DDK
Expression Host HEK293T
Cytochrome p450 2C19 (CYP2C19) (NM_000769) Human Tagged ORF Clone
RG211377

USD 500.00

2 Weeks

CYP2C19 (GFP-tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cytochrome p450 2C19 (CYP2C19) (NM_000769) Human Tagged ORF Clone Lentiviral Particle
RC211377L3V

USD 850.00

7 Weeks

Lenti ORF particles, CYP2C19 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cytochrome p450 2C19 (CYP2C19) (NM_000769) Human Tagged ORF Clone Lentiviral Particle
RC211377L4V

USD 850.00

3 Weeks

Lenti ORF particles, CYP2C19 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cytochrome p450 2C19 (CYP2C19) (NM_000769) Human Untagged Clone
SC310864

USD 830.00

In Stock

CYP2C19 (untagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Cytochrome p450 2C19 (CYP2C19) Rabbit Polyclonal Antibody
TA346224

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-CYP2C19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2C19 antibody: synthetic peptide directed towards the middle region of human CYP2C19. Synthetic peptide located within the following region: QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD
Cytochrome p450 2C19 (CYP2C19) Rabbit Polyclonal Antibody
TA347771

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Cytochrome P450 2C19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Cytochrome P450 2C19 Antibody: A synthesized peptide derived from human Cytochrome P450 2C19
Cytochrome p450 2C19 (CYP2C19) Rabbit Polyclonal Antibody
AP17267PU-N

USD 450.00

2 Weeks

Cytochrome p450 2C19 (CYP2C19) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 257-285 amino acids from the Central region of Human CYP2C19.
Cytochrome p450 2C19 (CYP2C19) (NM_000769) Human Tagged ORF Clone
RC211377L2

USD 650.00

3 Weeks

Lenti ORF clone of Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Cytochrome p450 2C19 (CYP2C19) (NM_000769) Human Over-expression Lysate
LY400260

USD 605.00

In Stock

Transient overexpression lysate of cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Cytochrome p450 2C19 (CYP2C19) (NM_000769) Human Mass Spec Standard
PH311377

USD 2,055.00

3 Weeks

CYP2C19 MS Standard C13 and N15-labeled recombinant protein (NP_000760)

Tag C-Myc/DDK
Expression Host HEK293
Cytochrome p450 2C19 (CYP2C19) ICC Control Block
TB411377

USD 1,100.00

4 Weeks

Transient overexpression of CYP2C19 (NM_000769) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cytochrome p450 2C19 (CYP2C19) Cytosection
TS411377

USD 225.00

4 Weeks

Transient overexpression of CYP2C19 (NM_000769) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Cytochrome p450 2C19 (CYP2C19) Cytosection
TS411377P5

USD 889.00

4 Weeks

Transient overexpression of CYP2C19 (NM_000769) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack