Products

cDNA Clones (32)
Proteins (17)
Antibodies (3)
Jump to Filters
View as table Download
CYP3A43 (NM_022820) Human Tagged ORF Clone
RC219323

USD 470.00

In Stock

CYP3A43 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CYP3A43 (NM_057095) Human Tagged ORF Clone
RC212311

USD 470.00

In Stock

CYP3A43 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CYP3A43 (NM_057096) Human Tagged ORF Clone
RC212367

USD 420.00

In Stock

CYP3A43 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CYP3A43 (NM_057095) Human Tagged ORF Clone Lentiviral Particle
RC212311L1V

USD 870.00

3 Weeks

Lenti ORF particles, CYP3A43 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CYP3A43 (NM_057095) Human Tagged ORF Clone Lentiviral Particle
RC212311L2V

USD 870.00

6 Weeks

Lenti ORF particles, CYP3A43 (mGFP-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CYP3A43 (NM_022820) Human Tagged ORF Clone Lentiviral Particle
RC219323L1V

USD 870.00

3 Weeks

Lenti ORF particles, CYP3A43 (Myc-DDK tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CYP3A43 (NM_022820) Human Tagged ORF Clone Lentiviral Particle
RC219323L2V

USD 870.00

6 Weeks

Lenti ORF particles, CYP3A43 (mGFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CYP3A43 (NM_057095) Human Tagged ORF Clone
RC212311L3

USD 670.00

3 Weeks

Lenti-ORF clone of CYP3A43 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CYP3A43 (NM_057095) Human Tagged ORF Clone Lentiviral Particle
RC212311L3V

USD 870.00

7 Weeks

Lenti ORF particles, CYP3A43 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CYP3A43 (NM_057095) Human Tagged ORF Clone
RC212311L4

USD 670.00

3 Weeks

Lenti-ORF clone of CYP3A43 (mGFP-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CYP3A43 (NM_057095) Human Tagged ORF Clone Lentiviral Particle
RC212311L4V

USD 870.00

7 Weeks

Lenti ORF particles, CYP3A43 (mGFP-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CYP3A43 (NM_057096) Human Tagged ORF Clone
RC212367L3

USD 620.00

3 Weeks

Lenti ORF clone of Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CYP3A43 (NM_057096) Human Tagged ORF Clone Lentiviral Particle
RC212367L3V

USD 820.00

6 Weeks

Lenti ORF particles, CYP3A43 (Myc-DDK tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CYP3A43 (NM_057096) Human Tagged ORF Clone
RC212367L4

USD 620.00

3 Weeks

Lenti ORF clone of Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CYP3A43 (NM_057096) Human Tagged ORF Clone Lentiviral Particle
RC212367L4V

USD 820.00

6 Weeks

Lenti ORF particles, CYP3A43 (mGFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CYP3A43 (NM_022820) Human Tagged ORF Clone
RC219323L3

USD 670.00

3 Weeks

Lenti ORF clone of Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CYP3A43 (NM_022820) Human Tagged ORF Clone Lentiviral Particle
RC219323L3V

USD 870.00

7 Weeks

Lenti ORF particles, CYP3A43 (Myc-DDK tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CYP3A43 (NM_022820) Human Tagged ORF Clone
RC219323L4

USD 670.00

3 Weeks

Lenti ORF clone of Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CYP3A43 (NM_022820) Human Tagged ORF Clone Lentiviral Particle
RC219323L4V

USD 870.00

7 Weeks

Lenti ORF particles, CYP3A43 (mGFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CYP3A43 (NM_001278921) Human Tagged ORF Clone
RC237940

USD 420.00

2 Weeks

CYP3A43 (myc-DDK-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CYP3A43 (NM_057095) Human Tagged ORF Clone
RG212311

USD 520.00

3 Weeks

CYP3A43 (GFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CYP3A43 (NM_057096) Human Tagged ORF Clone
RG212367

USD 460.00

3 Weeks

CYP3A43 (GFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CYP3A43 (NM_022820) Human Tagged ORF Clone
RG219323

USD 520.00

3 Weeks

CYP3A43 (GFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CYP3A43 (NM_057095) Human Tagged ORF Clone
RC212311L1

USD 670.00

In Stock

Lenti-ORF clone of CYP3A43 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CYP3A43 (NM_022820) Human Tagged ORF Clone
RC219323L1

USD 670.00

In Stock

Lenti ORF clone of Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CYP3A43 (NM_022820) Human Untagged Clone
SC305055

USD 850.00

In Stock

CYP3A43 (untagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CYP3A43 (NM_022820) Human Over-expression Lysate
LY411527

USD 605.00

In Stock

Transient overexpression lysate of cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CYP3A43 (NM_057095) Human Tagged ORF Clone
RC212311L2

USD 670.00

3 Weeks

Lenti-ORF clone of CYP3A43 (mGFP-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CYP3A43 (NM_022820) Human Tagged ORF Clone
RC219323L2

USD 670.00

3 Weeks

Lenti ORF clone of Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CYP3A43 (NM_057095) Human Over-expression Lysate
LC409258

USD 187.00

In Stock

CYP3A43 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CYP3A43 (NM_022820) Human Over-expression Lysate
LC411527

USD 187.00

In Stock

CYP3A43 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CYP3A43 (NM_057095) Human Over-expression Lysate
LY409258

USD 605.00

In Stock

Transient overexpression lysate of cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CYP3A43 Rabbit Polyclonal Antibody
TA315747

USD 345.00

4 Weeks

Rabbit polyclonal Cytochrome P450 3A43 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A43.
CYP3A43 Rabbit Polyclonal Antibody
TA338621

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYP3A43 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP3A43 antibody: synthetic peptide directed towards the middle region of human CYP3A43. Synthetic peptide located within the following region: ERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIII
CYP3A43 Rabbit Polyclonal Antibody
TA338622

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYP3A43 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP3A43 antibody: synthetic peptide directed towards the C terminal of human CYP3A43. Synthetic peptide located within the following region: IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR
CYP3A43 (NM_057096) Human Over-expression Lysate
LC409259

USD 187.00

2 Weeks

CYP3A43 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CYP3A43 (NM_057096) Human Over-expression Lysate
LY409259

USD 605.00

5 Days

Transient overexpression lysate of cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CYP3A43 (NM_001278921) Human Tagged ORF Clone
RG237940

USD 460.00

2 Weeks

CYP3A43 (GFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CYP3A43 (NM_057095) Human Untagged Clone
SC305739

USD 850.00

3 Weeks

CYP3A43 (untagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CYP3A43 (NM_057096) Human Untagged Clone
SC305740

USD 710.00

3 Weeks

CYP3A43 (untagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CYP3A43 (NM_001278921) Human Untagged Clone
SC335834

USD 390.00

2 Weeks

CYP3A43 (untagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CYP3A43 (NM_057095) ICC Control Block
TB412311

USD 1,120.00

4 Weeks

Transient overexpression of CYP3A43 (NM_057095) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CYP3A43 (NM_057096) ICC Control Block
TB412367

USD 1,070.00

4 Weeks

Transient overexpression of CYP3A43 (NM_057096) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CYP3A43 (NM_022820) ICC Control Block
TB419323

USD 1,120.00

4 Weeks

Transient overexpression of CYP3A43 (NM_022820) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CYP3A43 (NM_001278921) ICC Control Block
TB437940

USD 1,070.00

4 Weeks

Transient overexpression of CYP3A43 (NM_001278921) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CYP3A43 Cytosection
TS412311

USD 225.00

4 Weeks

Transient overexpression of CYP3A43 (NM_057095) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CYP3A43 Cytosection
TS412311P5

USD 889.00

4 Weeks

Transient overexpression of CYP3A43 (NM_057095) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CYP3A43 Cytosection
TS412367

USD 225.00

4 Weeks

Transient overexpression of CYP3A43 (NM_057096) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CYP3A43 Cytosection
TS412367P5

USD 889.00

4 Weeks

Transient overexpression of CYP3A43 (NM_057096) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CYP3A43 Cytosection
TS419323

USD 225.00

4 Weeks

Transient overexpression of CYP3A43 (NM_022820) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack