CYP3A43 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYP3A43 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYP3A43 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYP3A43 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CYP3A43 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CYP3A43 (mGFP-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, CYP3A43 (Myc-DDK tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CYP3A43 (mGFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti-ORF clone of CYP3A43 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP3A43 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CYP3A43 (mGFP-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP3A43 (mGFP-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP3A43 (Myc-DDK tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP3A43 (mGFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP3A43 (Myc-DDK tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CYP3A43 (mGFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CYP3A43 (myc-DDK-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYP3A43 (GFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CYP3A43 (GFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CYP3A43 (GFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of CYP3A43 (Myc-DDK-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
CYP3A43 (untagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti-ORF clone of CYP3A43 (mGFP-tagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CYP3A43 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CYP3A43 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal Cytochrome P450 3A43 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A43. |
Rabbit Polyclonal Anti-CYP3A43 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A43 antibody: synthetic peptide directed towards the middle region of human CYP3A43. Synthetic peptide located within the following region: ERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIII |
Rabbit Polyclonal Anti-CYP3A43 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A43 antibody: synthetic peptide directed towards the C terminal of human CYP3A43. Synthetic peptide located within the following region: IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR |
CYP3A43 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CYP3A43 (GFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CYP3A43 (untagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CYP3A43 (untagged)-Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CYP3A43 (untagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 43 (CYP3A43), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of CYP3A43 (NM_057095) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP3A43 (NM_057096) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP3A43 (NM_022820) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP3A43 (NM_001278921) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP3A43 (NM_057095) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP3A43 (NM_057095) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CYP3A43 (NM_057096) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP3A43 (NM_057096) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CYP3A43 (NM_022820) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack