Products

View as table Download

SETDB2 (Myc-DDK-tagged)-Human SET domain, bifurcated 2 (SETDB2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

SETDB2 (Myc-DDK-tagged)-Human SET domain, bifurcated 2 (SETDB2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, SETDB2 (Myc-DDK tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, SETDB2 (mGFP-tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, SETDB2 (Myc-DDK tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, SETDB2 (mGFP-tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

SETDB2 (GFP-tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SETDB2 (Myc-DDK tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SETDB2 (mGFP-tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SETDB2 (Myc-DDK tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SETDB2 (mGFP-tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

SETDB2 (GFP-tagged) - Human SET domain, bifurcated 2 (SETDB2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-SETDB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SETDB2 antibody: synthetic peptide directed towards the N terminal of human SETDB2. Synthetic peptide located within the following region: ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTGNKE

Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human SET domain, bifurcated 2 (SETDB2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

SETDB2 (untagged)-Human SET domain, bifurcated 2 (SETDB2), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Goat Polyclonal Antibody against SETDB2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence GEKNGDAKTFWME-C, from the N Terminus of the protein sequence according to NP_114121.1.

SETDB2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

SETDB2 (untagged)-Human SET domain bifurcated 2 (SETDB2) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of SETDB2 (NM_031915) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of SETDB2 (NM_001160308) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of SETDB2 (NM_031915) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of SETDB2 (NM_031915) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of SETDB2 (NM_001160308) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of SETDB2 (NM_001160308) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack