Products

Proteins (12)
cDNA Clones (11)
Antibodies (5)
Jump to Filters
View as table Download
Cathepsin S (CTSS) (NM_004079) Human Tagged ORF Clone
RC201215

USD 98.00

USD 470.00

In Stock

CTSS (Myc-DDK-tagged)-Human cathepsin S (CTSS), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Cathepsin S (CTSS) (NM_004079) Human Tagged ORF Clone
RG201215

USD 460.00

In Stock

CTSS (GFP-tagged) - Human cathepsin S (CTSS), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cathepsin S (CTSS) (NM_004079) Human Tagged ORF Clone
RC201215L3

USD 620.00

3 Weeks

Lenti ORF clone of Human cathepsin S (CTSS), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cathepsin S (CTSS) (NM_004079) Human Tagged ORF Clone
RC201215L4

USD 620.00

3 Weeks

Lenti ORF clone of Human cathepsin S (CTSS), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cathepsin S (CTSS) (NM_001199739) Human Tagged ORF Clone
RC233630

USD 420.00

3 Weeks

CTSS (Myc-DDK tagged) - Homo sapiens cathepsin S (CTSS), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cathepsin S (CTSS) (NM_001199739) Human Tagged ORF Clone
RG233630

USD 460.00

3 Weeks

CTSS (GFP-tagged) - Homo sapiens cathepsin S (CTSS), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cathepsin S (CTSS) (NM_004079) Human Untagged Clone
SC117580

USD 310.00

In Stock

CTSS (untagged)-Human cathepsin S (CTSS), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Cathepsin S (CTSS) (NM_004079) Human Untagged Clone
SC319097

USD 660.00

In Stock

CTSS (untagged)-Human cathepsin S (CTSS), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Cathepsin S (CTSS) (NM_004079) Human Over-expression Lysate
LY401317

USD 396.00

2 Weeks

Transient overexpression lysate of cathepsin S (CTSS)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Cathepsin S (CTSS) Mouse Monoclonal Antibody [Clone ID: AT1F9]
AM50049PU-N

USD 340.00

2 Weeks

Cathepsin S (CTSS) mouse monoclonal antibody, clone AT1F9, Purified

Applications ELISA, WB
Reactivities Human
Cathepsin S (CTSS) Mouse Monoclonal Antibody [Clone ID: AT1F9]
AM50049PU-S

USD 230.00

2 Weeks

Cathepsin S (CTSS) mouse monoclonal antibody, clone AT1F9, Purified

Applications ELISA, WB
Reactivities Human
Cathepsin S (CTSS) (NM_004079) Human Over-expression Lysate
LC401317

USD 121.00

In Stock

CTSS HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Cathepsin S (CTSS) Rabbit Polyclonal Antibody
TA308573

USD 415.00

5 Days

Rabbit polyclonal antibody to Cathepsin S (cathepsin S)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 32 and 265 of Cathepsin S (Uniprot ID#P25774)
Cathepsin S (CTSS) Rabbit Polyclonal Antibody
TA343088

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-CTSS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTSS antibody: synthetic peptide directed towards the N terminal of human CTSS. Synthetic peptide located within the following region: QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEH
Cathepsin S (CTSS) Rabbit Polyclonal Antibody
AP17262PU-N

USD 450.00

2 Weeks

Cathepsin S (CTSS) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human CTSS
Cathepsin S (17-331, His-tag) Human Protein
AR50775PU-N

USD 845.00

2 Weeks

Cathepsin S (17-331, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Cathepsin S (17-331, His-tag) Human Protein
AR50775PU-S

USD 330.00

2 Weeks

Cathepsin S (17-331, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Cathepsin S (CTSS) ICC Control Block
TB401215

USD 1,120.00

4 Weeks

Transient overexpression of CTSS (NM_004079) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cathepsin S (CTSS) ICC Control Block
TB433630

USD 1,070.00

4 Weeks

Transient overexpression of CTSS (NM_001199739) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cathepsin S (CTSS) (NM_004079) Human Recombinant Protein
TP720344L

USD 1,900.00

3 Weeks

Recombinant protein of human cathepsin S (CTSS)

Tag C-His
Expression Host HEK293
Cathepsin S (CTSS) (NM_004079) Human Recombinant Protein
TP720344M

USD 760.00

3 Weeks

Recombinant protein of human cathepsin S (CTSS)

Tag C-His
Expression Host HEK293
Cathepsin S (CTSS) (NM_004079) Human Recombinant Protein
TP720344XL

USD 2,800.00

3 Weeks

Recombinant protein of human cathepsin S (CTSS)

Tag C-His
Expression Host HEK293
Cathepsin S (CTSS) Cytosection
TS401215

USD 225.00

4 Weeks

Transient overexpression of CTSS (NM_004079) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Cathepsin S (CTSS) Cytosection
TS401215P5

USD 889.00

4 Weeks

Transient overexpression of CTSS (NM_004079) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Cathepsin S (CTSS) ICC Control Sections
TS433630P5

USD 889.00

4 Weeks

Transient overexpression of CTSS (NM_001199739) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack