Germany
Japan
United Kingdom
China
GGA2 (Myc-DDK-tagged)-Human golgi-associated, gamma adaptin ear containing, ARF binding protein 2 (GGA2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, GGA2 (Myc-DDK tagged) - Human golgi-associated, gamma adaptin ear containing, ARF binding protein 2 (GGA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, GGA2 (mGFP-tagged) - Human golgi-associated, gamma adaptin ear containing, ARF binding protein 2 (GGA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
Recombinant protein of human golgi associated, gamma adaptin ear containing, ARF binding protein 2 (GGA2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
GGA2 (GFP-tagged) - Human golgi-associated, gamma adaptin ear containing, ARF binding protein 2 (GGA2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human golgi-associated, gamma adaptin ear containing, ARF binding protein 2 (GGA2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GGA2 (Myc-DDK tagged) - Human golgi-associated, gamma adaptin ear containing, ARF binding protein 2 (GGA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human golgi-associated, gamma adaptin ear containing, ARF binding protein 2 (GGA2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GGA2 (mGFP-tagged) - Human golgi-associated, gamma adaptin ear containing, ARF binding protein 2 (GGA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human golgi-associated, gamma adaptin ear containing, ARF binding protein 2 (GGA2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
GGA2 (untagged)-Human golgi-associated, gamma adaptin ear containing, ARF binding protein 2 (GGA2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of golgi associated, gamma adaptin ear containing, ARF binding protein 2 (GGA2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human golgi-associated, gamma adaptin ear containing, ARF binding protein 2 (GGA2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
GGA2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GGA2 (untagged)-Human golgi associated, gamma adaptin ear containing, ARF binding protein 2 (GGA2), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Anti-GGA2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 300 amino acids of human golgi-associated, gamma adaptin ear containing, ARF binding protein 2 |
Rabbit Polyclonal Anti-GGA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GGA2 antibody is: synthetic peptide directed towards the N-terminal region of Human GGA2. Synthetic peptide located within the following region: MLKKQGIIKQDPKLPVDKILPPPSPWPKSSIFDADEEKSKLLTRLLKSNH |
Carrier-free (glycerol/BSA-free) GGA2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GGA2 MS Standard C13 and N15-labeled recombinant protein (NP_055859)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
GGA2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GGA2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
GGA2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
GGA2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Transient overexpression of GGA2 (NM_015044) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GGA2 (NM_015044) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GGA2 (NM_015044) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GGA2
Pathways
- Lysosome