NAGPA (Myc-DDK-tagged)-Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
NAGPA (Myc-DDK-tagged)-Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, NAGPA (Myc-DDK tagged) - Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, NAGPA (mGFP-tagged) - Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NAGPA (Myc-DDK tagged) - Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, NAGPA (mGFP-tagged) - Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
NAGPA (GFP-tagged) - Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
NAGPA (untagged)-Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-NAGPA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NAGPA antibody is: synthetic peptide directed towards the N-terminal region of Human NAGPA. Synthetic peptide located within the following region: GECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPF |
NAGPA HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
NAGPA MS Standard C13 and N15-labeled recombinant protein (NP_057340)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of NAGPA (NM_016256) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of NAGPA (NM_016256) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of NAGPA (NM_016256) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack