Products

cDNA Clones (11)
Proteins (7)
Antibodies (1)
Jump to Filters
View as table Download
NAGPA (NM_016256) Human Tagged ORF Clone
RC218271

USD 470.00

In Stock

NAGPA (Myc-DDK-tagged)-Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
NAGPA (NM_016256) Human Tagged ORF Clone Lentiviral Particle
RC218271L1V

USD 870.00

3 Weeks

Lenti ORF particles, NAGPA (Myc-DDK tagged) - Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
NAGPA (NM_016256) Human Tagged ORF Clone Lentiviral Particle
RC218271L2V

USD 870.00

6 Weeks

Lenti ORF particles, NAGPA (mGFP-tagged) - Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
NAGPA (NM_016256) Human Tagged ORF Clone
RC218271L3

USD 670.00

3 Weeks

Lenti ORF clone of Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NAGPA (NM_016256) Human Tagged ORF Clone Lentiviral Particle
RC218271L3V

USD 870.00

5 Weeks

Lenti ORF particles, NAGPA (Myc-DDK tagged) - Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NAGPA (NM_016256) Human Tagged ORF Clone
RC218271L4

USD 670.00

3 Weeks

Lenti ORF clone of Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NAGPA (NM_016256) Human Tagged ORF Clone Lentiviral Particle
RC218271L4V

USD 870.00

7 Weeks

Lenti ORF particles, NAGPA (mGFP-tagged) - Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NAGPA (NM_016256) Human Tagged ORF Clone
RG218271

USD 520.00

3 Weeks

NAGPA (GFP-tagged) - Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NAGPA (NM_016256) Human Tagged Lenti ORF Clone
RC218271L1

USD 828.00

In Stock

Lenti ORF clone of Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
NAGPA (NM_016256) Human Tagged ORF Clone
RC218271L2

USD 670.00

3 Weeks

Lenti ORF clone of Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
NAGPA (NM_016256) Human Untagged Clone
SC114360

USD 870.00

In Stock

NAGPA (untagged)-Human N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
NAGPA (NM_016256) Human Over-expression Lysate
LY414096

USD 605.00

5 Days

Transient overexpression lysate of N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (NAGPA)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NAGPA Rabbit Polyclonal Antibody
TA342008

USD 375.00

5 Days

Rabbit Polyclonal Anti-NAGPA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NAGPA antibody is: synthetic peptide directed towards the N-terminal region of Human NAGPA. Synthetic peptide located within the following region: GECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVTGYLSEEEVLDTENPF
NAGPA (NM_016256) Human Over-expression Lysate
LC414096

USD 187.00

2 Weeks

NAGPA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NAGPA (NM_016256) Human Mass Spec Standard
PH318271

USD 2,055.00

3 Weeks

NAGPA MS Standard C13 and N15-labeled recombinant protein (NP_057340)

Tag C-Myc/DDK
Expression Host HEK293
NAGPA (NM_016256) ICC Control Block
TB418271

USD 1,120.00

4 Weeks

Transient overexpression of NAGPA (NM_016256) in HEK293T cells paraffin embedded controls for ICC/IHC staining

NAGPA Cytosection
TS418271

USD 225.00

4 Weeks

Transient overexpression of NAGPA (NM_016256) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

NAGPA Cytosection
TS418271P5

USD 889.00

4 Weeks

Transient overexpression of NAGPA (NM_016256) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack