Products

View as table Download

MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, MECOM (mGFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

MECOM (GFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MECOM (Myc-DDK tagged) - Homo sapiens MDS1 and EVI1 complex locus (MECOM), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

MECOM (GFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MECOM (GFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MECOM (Myc-DDK tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MECOM (Myc-DDK tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MECOM (mGFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of MECOM (mGFP-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MECOM (mGFP-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 6

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 6, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of MECOM (mGFP-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 6

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 5

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of MECOM (mGFP-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 5

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MECOM (Myc-DDK-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of MECOM (mGFP-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MECOM (GFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MECOM (GFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MECOM (GFP-tagged) - Human MDS1 and EVI1 complex locus (MECOM), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MECOM (GFP-tagged) - Homo sapiens MDS1 and EVI1 complex locus (MECOM), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

MECOM (untagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit anti-MECOM Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MECOM

Rabbit Polyclonal Anti-EVI1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the middle region of human EVI1. Synthetic peptide located within the following region: KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT

Rabbit Polyclonal Anti-EVI1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the middle region of human EVI1. Synthetic peptide located within the following region: KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT

Rabbit Polyclonal Anti-EVI1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the N terminal of human EVI1. Synthetic peptide located within the following region: VKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKHPSVGDNKPVELQP