Products

cDNA Clones (9)
Proteins (6)
Antibodies (4)
Jump to Filters
View as table Download
nkx6.1 (NKX6-1) (NM_006168) Human Tagged ORF Clone
RC224762

USD 420.00

In Stock

NKX6 (Myc-DDK-tagged)-Human NK6 homeobox 1 (NKX6-1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
nkx6.1 (NKX6-1) (NM_006168) Human Tagged ORF Clone
RG224762

USD 460.00

In Stock

NKX6 (GFP-tagged) - Human NK6 homeobox 1 (NKX6-1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
nkx6.1 (NKX6-1) Rabbit Polyclonal Antibody
TA309767

USD 512.00

In Stock

Rabbit Polyclonal Nkx6.1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human Nkx6.1 protein (within residues 50-200). [Swiss-Prot P78426]
nkx6.1 (NKX6-1) (NM_006168) Human Untagged Clone
SC303741

USD 630.00

In Stock

NKX6 (untagged)-Human NK6 homeobox 1 (NKX6-1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
nkx6.1 (NKX6-1) (NM_006168) Human Recombinant Protein
TP761833

USD 215.00

In Stock

Purified recombinant protein of Human NK6 homeobox 1 (NKX6-1), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
nkx6.1 (NKX6-1) (NM_006168) Human Over-expression Lysate
LC401859

USD 121.00

In Stock

NKX6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
nkx6.1 (NKX6-1) (NM_006168) Human Over-expression Lysate
LY401859

USD 396.00

5 Days

Transient overexpression lysate of NK6 homeobox 1 (NKX6-1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
nkx6.1 (NKX6-1) (C-term) Rabbit Polyclonal Antibody
AP52893PU-N

USD 450.00

2 Weeks

nkx6.1 (NKX6-1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 284-314aa) of human NKX6-1
nkx6.1 (NKX6-1) Rabbit Polyclonal Antibody
TA312303

USD 345.00

4 Weeks

Rabbit polyclonal anti-NKX61 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human NKX6-1.
nkx6.1 (NKX6-1) Rabbit Polyclonal Antibody
TA331124

USD 375.00

5 Days

Rabbit Polyclonal Anti-NKX6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NKX6-1 antibody: synthetic peptide directed towards the N terminal of human NKX6-1. Synthetic peptide located within the following region: MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPSS
nkx6.1 (NKX6-1) ICC Control Block
TB424762

USD 1,070.00

4 Weeks

Transient overexpression of NKX6 (NM_006168) in HEK293T cells paraffin embedded controls for ICC/IHC staining

nkx6.1 (NKX6-1) Cytosection
TS424762

USD 225.00

4 Weeks

Transient overexpression of NKX6 (NM_006168) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

nkx6.1 (NKX6-1) Cytosection
TS424762P5

USD 889.00

4 Weeks

Transient overexpression of NKX6 (NM_006168) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack