Germany
Japan
United Kingdom
China
CREB3L2 (Myc-DDK-tagged)-Human cAMP responsive element binding protein 3-like 2 (CREB3L2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CREB3L2 (Myc-DDK tagged) - Human cAMP responsive element binding protein 3-like 2 (CREB3L2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CREB3L2 (mGFP-tagged) - Human cAMP responsive element binding protein 3-like 2 (CREB3L2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CREB3L2 (GFP-tagged) - Human cAMP responsive element binding protein 3-like 2 (CREB3L2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cAMP responsive element binding protein 3-like 2 (CREB3L2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CREB3L2 (Myc-DDK tagged) - Human cAMP responsive element binding protein 3-like 2 (CREB3L2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cAMP responsive element binding protein 3-like 2 (CREB3L2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CREB3L2 (mGFP-tagged) - Human cAMP responsive element binding protein 3-like 2 (CREB3L2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CREB3L2 (Myc-DDK tagged) - Homo sapiens cAMP responsive element binding protein 3-like 2 (CREB3L2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CREB3L2 (GFP-tagged) - Homo sapiens cAMP responsive element binding protein 3-like 2 (CREB3L2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cAMP responsive element binding protein 3-like 2 (CREB3L2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of cAMP responsive element binding protein 3-like 2 (CREB3L2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human cAMP responsive element binding protein 3-like 2 (CREB3L2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CREB3L2 (untagged)-Human cAMP responsive element binding protein 3-like 2 (CREB3L2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-CREB3L2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CREB3L2. |
CREB3L2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-CREB3L2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CREB3L2 antibody: synthetic peptide directed towards the N terminal of human CREB3L2. Synthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF |
Goat Polyclonal Anti-CREB3L2 / BBF2H7 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | internal region of NP_919047.2 (HSLQEPYTASVVRS) |
Rabbit polyclonal CREB3L2 Antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CREB3L2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 490-517 amino acids from the C-terminal region of human CREB3L2. |
CREB3L2 (1-378, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
CREB3L2 (1-378, His-tag) human recombinant protein, 20 µg
| Tag | His-tag |
| Expression Host | E. coli |
CREB3L2 (untagged) - Homo sapiens cAMP responsive element binding protein 3-like 2 (CREB3L2), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of CREB3L2 (NM_194071) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CREB3L2 (NM_001253775) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CREB3L2 (NM_194071) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CREB3L2 (NM_194071) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CREB3L2 (NM_001253775) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CREB3L2
Pathways
- Melanogenesis