GNAQ (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GNAQ (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, GNAQ (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GNAQ (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GNAQ (GFP-tagged) - Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GNAQ (Myc-DDK tagged) - Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GNAQ (mGFP-tagged) - Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GNAQ (untagged)-Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GNAQ Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAQ antibody: synthetic peptide directed towards the N terminal of human GNAQ. Synthetic peptide located within the following region: DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK |
Lenti ORF clone of Human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
GNAQ HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of guanine nucleotide binding protein (G protein), q polypeptide (GNAQ)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Goat Anti-GNAQ / ALPHA-q (aa162-175) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NDLDRVADPAYLPT, from the internal region of the protein sequence according to NP_002063.2. |
G protein alpha Q / GNAQ (1-359, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
G protein alpha Q / GNAQ (1-359, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
GNAQ MS Standard C13 and N15-labeled recombinant protein (NP_002063)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of GNAQ (NM_002072) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GNAQ (NM_002072) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GNAQ (NM_002072) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack