Products

cDNA Clones (7)
Proteins (6)
Antibodies (1)
Jump to Filters
View as table Download
ACSM4 (NM_001080454) Human Tagged ORF Clone
RC213310

USD 540.00

In Stock

ACSM4 (Myc-DDK-tagged)-Human acyl-CoA synthetase medium-chain family member 4 (ACSM4)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ACSM4 (NM_001080454) Human Tagged ORF Clone
RC213310L3

USD 740.00

3 Weeks

Lenti ORF clone of Human acyl-CoA synthetase medium-chain family member 4 (ACSM4), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACSM4 (NM_001080454) Human Tagged ORF Clone Lentiviral Particle
RC213310L3V

USD 940.00

6 Weeks

Lenti ORF particles, ACSM4 (Myc-DDK tagged) - Human acyl-CoA synthetase medium-chain family member 4 (ACSM4), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ACSM4 (NM_001080454) Human Tagged ORF Clone
RC213310L4

USD 740.00

3 Weeks

Lenti ORF clone of Human acyl-CoA synthetase medium-chain family member 4 (ACSM4), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACSM4 (NM_001080454) Human Tagged ORF Clone Lentiviral Particle
RC213310L4V

USD 940.00

6 Weeks

Lenti ORF particles, ACSM4 (mGFP-tagged) - Human acyl-CoA synthetase medium-chain family member 4 (ACSM4), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ACSM4 (NM_001080454) Human Tagged ORF Clone
RG213310

USD 590.00

3 Weeks

ACSM4 (GFP-tagged) - Human acyl-CoA synthetase medium-chain family member 4 (ACSM4)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ACSM4 Rabbit Polyclonal Antibody
TA332218

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACSM4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACSM4 Antibody is: synthetic peptide directed towards the N-terminal region of Human ACSM4. Synthetic peptide located within the following region: DQWSQKEKTGERPANPALWWVNGKGDEVKWSFRELGSLSRKAANVLTKPC
ACSM4 (NM_001080454) Human Over-expression Lysate
LC420712

USD 187.00

2 Weeks

ACSM4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ACSM4 (NM_001080454) Human Over-expression Lysate
LY420712

USD 605.00

5 Days

Transient overexpression lysate of acyl-CoA synthetase medium-chain family member 4 (ACSM4)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ACSM4 (NM_001080454) Human Mass Spec Standard
PH313310

USD 2,055.00

3 Weeks

ACSM4 MS Standard C13 and N15-labeled recombinant protein (NP_001073923)

Tag C-Myc/DDK
Expression Host HEK293
ACSM4 (NM_001080454) Human Untagged Clone
SC315804

USD 980.00

3 Weeks

ACSM4 (untagged)-Human acyl-CoA synthetase medium-chain family member 4 (ACSM4)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ACSM4 (NM_001080454) ICC Control Block
TB413310

USD 1,190.00

4 Weeks

Transient overexpression of ACSM4 (NM_001080454) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ACSM4 Cytosection
TS413310

USD 225.00

4 Weeks

Transient overexpression of ACSM4 (NM_001080454) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ACSM4 Cytosection
TS413310P5

USD 889.00

4 Weeks

Transient overexpression of ACSM4 (NM_001080454) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack