BCL2A1 (Myc-DDK-tagged)-Human BCL2-related protein A1 (BCL2A1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
BCL2A1 (Myc-DDK-tagged)-Human BCL2-related protein A1 (BCL2A1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
BCL2A1 (Myc-DDK-tagged)-Human BCL2-related protein A1 (BCL2A1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, BCL2A1 (Myc-DDK tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, BCL2A1 (mGFP-tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
BCL2A1 (GFP-tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, BCL2A1 (Myc-DDK tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, BCL2A1 (mGFP-tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human BCL2-related protein A1 (BCL2A1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, BCL2A1 (Myc-DDK tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human BCL2-related protein A1 (BCL2A1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, BCL2A1 (mGFP-tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
BCL2A1 (GFP-tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
BCL2A1 (untagged)-Human BCL2-related protein A1 (BCL2A1), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human BCL2-related protein A1 (BCL2A1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human BCL2-related protein A1 (BCL2A1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human BCL2-related protein A1 (BCL2A1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
BCL2A1 (Center) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 63~92 amino acids from the Center region of human BCL2A1 |
BCL2A1 (untagged)-Human BCL2-related protein A1 (BCL2A1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Bfl-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Bfl-1 antibody was raised against a 14 amino acid peptide from near the amino terminus of human Bfl-1. |
BCL2A1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human BCL2-related protein A1 (BCL2A1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Bfl-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Bfl-1 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human Bfl-1. |
BCL2A1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Bcl-2-like 5 (1-152, His-tag) human recombinant protein, 20 µg
Tag | His-tag |
Expression Host | E. coli |
Goat Anti-BCL2A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NVVSVDTART, from the internal region of the protein sequence according to NP_004040.1; NP_001108207.1. |
Rabbit Polyclonal Anti-BCL2A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BCL2A1 antibody: synthetic peptide directed towards the C terminal of human BCL2A1. Synthetic peptide located within the following region: FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY |
Bcl-2-like 5 (1-152, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression lysate of BCL2-related protein A1 (BCL2A1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression lysate of BCL2-related protein A1 (BCL2A1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Anti-BCL2A1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-175 amino acids of human BCL2-related protein A1 |
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of BCL2A1 (NM_004049) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of BCL2A1 (NM_001114735) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human BCL2-related protein A1 (BCL2A1), transcript variant 2
Tag | C-His |
Expression Host | E. coli |
Recombinant protein of human BCL2-related protein A1 (BCL2A1), transcript variant 2
Tag | C-His |
Expression Host | E. coli |
Recombinant protein of human BCL2-related protein A1 (BCL2A1), transcript variant 2
Tag | C-His |
Expression Host | E. coli |
Recombinant protein of human BCL2-related protein A1 (BCL2A1), transcript variant 2
Tag | C-His |
Expression Host | E. coli |
Transient overexpression of BCL2A1 (NM_004049) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of BCL2A1 (NM_004049) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of BCL2A1 (NM_001114735) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of BCL2A1 (NM_001114735) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack