Products

View as table Download

USD 98.00

USD 390.00

In Stock

BCL2A1 (Myc-DDK-tagged)-Human BCL2-related protein A1 (BCL2A1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

BCL2A1 (Myc-DDK-tagged)-Human BCL2-related protein A1 (BCL2A1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, BCL2A1 (Myc-DDK tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, BCL2A1 (mGFP-tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

BCL2A1 (GFP-tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, BCL2A1 (Myc-DDK tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, BCL2A1 (mGFP-tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human BCL2-related protein A1 (BCL2A1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, BCL2A1 (Myc-DDK tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human BCL2-related protein A1 (BCL2A1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, BCL2A1 (mGFP-tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

BCL2A1 (GFP-tagged) - Human BCL2-related protein A1 (BCL2A1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

BCL2A1 (untagged)-Human BCL2-related protein A1 (BCL2A1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human BCL2-related protein A1 (BCL2A1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

BCL2A1 (Center) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 63~92 amino acids from the Center region of human BCL2A1

BCL2A1 (untagged)-Human BCL2-related protein A1 (BCL2A1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Bfl-1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Bfl-1 antibody was raised against a 14 amino acid peptide from near the amino terminus of human Bfl-1.

BCL2A1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human BCL2-related protein A1 (BCL2A1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Bfl-1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Bfl-1 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human Bfl-1.

BCL2A1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Bcl-2-like 5 (1-152, His-tag) human recombinant protein, 20 µg

Tag His-tag
Expression Host E. coli

Goat Anti-BCL2A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NVVSVDTART, from the internal region of the protein sequence according to NP_004040.1; NP_001108207.1.

Rabbit Polyclonal Anti-BCL2A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCL2A1 antibody: synthetic peptide directed towards the C terminal of human BCL2A1. Synthetic peptide located within the following region: FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY

Bcl-2-like 5 (1-152, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

Carrier-free (BSA/glycerol-free) BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Anti-BCL2A1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-175 amino acids of human BCL2-related protein A1

BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)

Applications WB
Reactivities Human
Conjugation Unconjugated

BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)

Applications WB
Reactivities Human
Conjugation Unconjugated

USD 1,040.00

4 Weeks

Transient overexpression of BCL2A1 (NM_004049) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,070.00

4 Weeks

Transient overexpression of BCL2A1 (NM_001114735) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Recombinant protein of human BCL2-related protein A1 (BCL2A1), transcript variant 2

Tag C-His
Expression Host E. coli

Recombinant protein of human BCL2-related protein A1 (BCL2A1), transcript variant 2

Tag C-His
Expression Host E. coli

Recombinant protein of human BCL2-related protein A1 (BCL2A1), transcript variant 2

Tag C-His
Expression Host E. coli

Recombinant protein of human BCL2-related protein A1 (BCL2A1), transcript variant 2

Tag C-His
Expression Host E. coli

USD 225.00

4 Weeks

Transient overexpression of BCL2A1 (NM_004049) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of BCL2A1 (NM_004049) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of BCL2A1 (NM_001114735) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of BCL2A1 (NM_001114735) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack