Products

cDNA Clones (29)
Antibodies (15)
Proteins (12)
Jump to Filters
View as table Download
CPS1 (NM_001875) Human Tagged ORF Clone
RC213008

USD 1,580.00

In Stock

CPS1 (Myc-DDK-tagged)-Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CPS1 (NM_001122633) Human Tagged ORF Clone
RC226402

USD 1,580.00

In Stock

CPS1 (Myc-DDK-tagged)-Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CPS1 (NM_001875) Human Tagged ORF Clone Lentiviral Particle
RC213008L1V

USD 1,980.00

6 Weeks

Lenti ORF particles, CPS1 (Myc-DDK tagged) - Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CPS1 (NM_001875) Human Tagged ORF Clone Lentiviral Particle
RC213008L2V

USD 1,980.00

3 Weeks

Lenti ORF particles, CPS1 (mGFP-tagged) - Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CPS1 (NM_001122633) Human Tagged ORF Clone Lentiviral Particle
RC226402L1V

USD 1,980.00

6 Weeks

Lenti ORF particles, CPS1 (Myc-DDK-tagged)-Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CPS1 (NM_001122633) Human Tagged ORF Clone Lentiviral Particle
RC226402L2V

USD 1,980.00

3 Weeks

Lenti ORF particles, CPS1 (mGFP-tagged)-Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CPS1 (NM_001122633) Human Tagged ORF Clone
RG226402

USD 1,740.00

In Stock

CPS1 (GFP-tagged) - Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CPS1 (NM_001875) Human Tagged ORF Clone
RC213008L3

USD 1,780.00

3 Weeks

Lenti ORF clone of Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CPS1 (NM_001875) Human Tagged ORF Clone Lentiviral Particle
RC213008L3V

USD 1,980.00

7 Weeks

Lenti ORF particles, CPS1 (Myc-DDK tagged) - Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CPS1 (NM_001875) Human Tagged ORF Clone
RC213008L4

USD 1,780.00

3 Weeks

Lenti ORF clone of Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CPS1 (NM_001875) Human Tagged ORF Clone Lentiviral Particle
RC213008L4V

USD 1,980.00

5 Weeks

Lenti ORF particles, CPS1 (mGFP-tagged) - Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CPS1 (NM_001122634) Human Tagged ORF Clone
RC226309

USD 1,100.00

5 Weeks

CPS1 (Myc-DDK-tagged)-Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CPS1 (NM_001122634) Human Tagged ORF Clone
RC226309L3

USD 1,300.00

8 Weeks

Lenti-ORF clone of CPS1 (Myc-DDK-tagged)-Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CPS1 (NM_001122634) Human Tagged ORF Clone Lentiviral Particle
RC226309L3V

USD 1,500.00

11 Weeks

Lenti ORF particles, CPS1 (Myc-DDK-tagged)-Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CPS1 (NM_001122634) Human Tagged ORF Clone
RC226309L4

USD 1,300.00

8 Weeks

Lenti-ORF clone of CPS1 (mGFP-tagged)-Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CPS1 (NM_001122634) Human Tagged ORF Clone Lentiviral Particle
RC226309L4V

USD 1,500.00

11 Weeks

Lenti ORF particles, CPS1 (mGFP-tagged)-Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CPS1 (NM_001122633) Human Tagged ORF Clone
RC226402L3

USD 1,780.00

3 Weeks

Lenti-ORF clone of CPS1 (Myc-DDK-tagged)-Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CPS1 (NM_001122633) Human Tagged ORF Clone Lentiviral Particle
RC226402L3V

USD 1,980.00

7 Weeks

Lenti ORF particles, CPS1 (Myc-DDK-tagged)-Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CPS1 (NM_001122633) Human Tagged ORF Clone
RC226402L4

USD 1,780.00

In Stock

Lenti-ORF clone of CPS1 (mGFP-tagged)-Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CPS1 (NM_001122633) Human Tagged ORF Clone Lentiviral Particle
RC226402L4V

USD 1,980.00

3 Weeks

Lenti ORF particles, CPS1 (mGFP-tagged)-Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CPS1 (NM_001875) Human Tagged ORF Clone
RG213008

USD 1,740.00

3 Weeks

CPS1 (GFP-tagged) - Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CPS1 (NM_001122634) Human Tagged ORF Clone
RG226309

USD 1,210.00

5 Weeks

CPS1 (GFP-tagged) - Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CPS1 (NM_001122633) Human Tagged Lenti ORF Clone
RC226402L2

USD 2,196.00

In Stock

Lenti-ORF clone of CPS1 (mGFP-tagged)-Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CPS1 (NM_001875) Human Over-expression Lysate
LY419674

USD 605.00

2 Weeks

Transient overexpression lysate of carbamoyl-phosphate synthetase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CPS1 (NM_001875) Human Tagged ORF Clone
RC213008L2

USD 1,780.00

In Stock

Lenti ORF clone of Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CPS1 Rabbit Monoclonal Antibody [Clone ID: EPR7493]
TA310349

USD 509.00

In Stock

Rabbit Monoclonal antibody against CPS1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CPS1 Mouse Monoclonal Antibody [Clone ID: 8H8]
AM31158PU-N

USD 480.00

2 Weeks

CPS1 mouse monoclonal antibody, clone 8H8, Purified

Applications ELISA, IHC, WB
Reactivities Human
CPS1 (NM_001122633) Human Over-expression Lysate
LC426538

USD 187.00

2 Weeks

CPS1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CPS1 (NM_001875) Human Tagged ORF Clone
RC213008L1

USD 1,780.00

3 Weeks

Lenti ORF clone of Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CPS1 (NM_001122633) Human Tagged ORF Clone
RC226402L1

USD 1,780.00

3 Weeks

Lenti-ORF clone of CPS1 (Myc-DDK-tagged)-Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CPS1 (NM_001122633) Human Untagged Clone
SC319031

USD 3,050.00

In Stock

CPS1 (untagged)-Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CPS1 (NM_001122633) Human Over-expression Lysate
LY426538

USD 605.00

In Stock

Transient overexpression lysate of carbamoyl-phosphate synthetase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CPS1 Rabbit Polyclonal Antibody
TA338262

USD 310.00

5 Days

Rabbit Polyclonal Anti-CPS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the N terminal of human CPS1. Synthetic peptide located within the following region: QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL
CPS1 Rabbit Polyclonal Antibody
TA338263

USD 310.00

5 Days

Rabbit Polyclonal Anti-CPS1 Antibody

Applications IHC, WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the middle region of human CPS1. Synthetic peptide located within the following region: YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI
CPS1 Mouse Monoclonal Antibody [Clone ID: OTI7B6]
CF813538

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CPS1 mouse monoclonal antibody, clone OTI7B6

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CPS1 (NM_001875) Human Over-expression Lysate
LC419674

USD 187.00

2 Weeks

CPS1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CPS1 (NM_001875) Human Untagged Clone
SC309032

USD 1,100.00

3 Weeks

CPS1 (untagged)-Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CPS1 (NM_001122634) Human Untagged Clone
SC319017

USD 1,100.00

5 Weeks

CPS1 (untagged)-Human carbamoyl-phosphate synthase 1, mitochondrial (CPS1), transcript variant 3

Vector pCMV6 series
Tag Tag Free
CPS1 Mouse Monoclonal Antibody [Clone ID: OTI7B6]
TA813538

USD 379.00

In Stock

CPS1 mouse monoclonal antibody, clone OTI7B6

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CPS1 Mouse Monoclonal Antibody [Clone ID: OTI7B6]
TA813538S

USD 159.00

2 Weeks

CPS1 mouse monoclonal antibody, clone OTI7B6

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CPS1 ICC Control Block
TB413008

USD 2,230.00

4 Weeks

Transient overexpression of CPS1 (NM_001875) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CPS1 ICC Control Block
TB426309

USD 1,750.00

4 Weeks

Transient overexpression of CPS1 (NM_001122634) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CPS1 ICC Control Block
TB426402

USD 2,230.00

4 Weeks

Transient overexpression of CPS1 (NM_001122633) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CPS1 Cytosection
TS413008

USD 225.00

4 Weeks

Transient overexpression of CPS1 (NM_001875) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CPS1 Cytosection
TS413008P5

USD 889.00

4 Weeks

Transient overexpression of CPS1 (NM_001875) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CPS1 ICC Control Sections
TS426309P5

USD 889.00

4 Weeks

Transient overexpression of CPS1 (NM_001122634) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CPS1 Cytosection
TS426402

USD 225.00

4 Weeks

Transient overexpression of CPS1 (NM_001122633) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CPS1 Cytosection
TS426402P5

USD 889.00

4 Weeks

Transient overexpression of CPS1 (NM_001122633) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack