CYP2C19 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYP2C19 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 850.00
3 Weeks
Lenti ORF particles, CYP2C19 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 850.00
6 Weeks
Lenti ORF particles, CYP2C19 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CYP2C19 (GFP-tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 850.00
7 Weeks
Lenti ORF particles, CYP2C19 (Myc-DDK tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 850.00
3 Weeks
Lenti ORF particles, CYP2C19 (mGFP-tagged) - Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CYP2C19 (untagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CYP2C19 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2C19 antibody: synthetic peptide directed towards the middle region of human CYP2C19. Synthetic peptide located within the following region: QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD |
Rabbit Polyclonal Anti-Cytochrome P450 2C19 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cytochrome P450 2C19 Antibody: A synthesized peptide derived from human Cytochrome P450 2C19 |
Cytochrome p450 2C19 (CYP2C19) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 257-285 amino acids from the Central region of Human CYP2C19. |
Cytochrome p450 2C19 (CYP2C19) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Lenti ORF clone of Human cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 187.00
In Stock
CYP2C19 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USD 605.00
In Stock
Transient overexpression lysate of cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CYP2C19 MS Standard C13 and N15-labeled recombinant protein (NP_000760)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of CYP2C19 (NM_000769) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CYP2C19 (NM_000769) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CYP2C19 (NM_000769) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack