Products

View as table Download

DGUOK (Myc-DDK-tagged)-Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, DGUOK (Myc-DDK tagged) - Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, DGUOK (mGFP-tagged) - Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

DGUOK (GFP-tagged) - Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

DGUOK (GFP-tagged) - Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DGUOK (Myc-DDK tagged) - Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DGUOK (mGFP-tagged) - Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DGUOK (Myc-DDK tagged) - Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DGUOK (mGFP-tagged) - Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

DGUOK (untagged)-Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Purified recombinant protein of Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli

Lenti ORF clone of Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Transient overexpression lysate of deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

DGUOK (untagged)-Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-DGUOK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGUOK antibody is: synthetic peptide directed towards the C-terminal region of Human DGUOK. Synthetic peptide located within the following region: EQLHGQHEAWLIHKTTKLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMRE

DGUOK HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

DGUOK HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

DGUOK MS Standard C13 and N15-labeled recombinant protein (NP_550438)

Tag C-Myc/DDK
Expression Host HEK293

Transient overexpression of DGUOK (NM_080916) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of DGUOK (NM_080918) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of DGUOK (NM_080916) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of DGUOK (NM_080916) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of DGUOK (NM_080918) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of DGUOK (NM_080918) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack