GANC (Myc-DDK-tagged)-Human glucosidase, alpha, neutral C (GANC)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
GANC (Myc-DDK-tagged)-Human glucosidase, alpha, neutral C (GANC)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of GANC (Myc-DDK-tagged)-Human glucosidase, alpha; neutral C (GANC)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GANC (Myc-DDK-tagged)-Human glucosidase, alpha; neutral C (GANC), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GANC (mGFP-tagged)-Human glucosidase, alpha; neutral C (GANC)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GANC (mGFP-tagged)-Human glucosidase, alpha; neutral C (GANC), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GANC (myc-DDK-tagged) - Human glucosidase, alpha, neutral C (GANC), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GANC (myc-DDK-tagged) - Human glucosidase, alpha, neutral C (GANC), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GANC (GFP-tagged) - Human glucosidase, alpha; neutral C (GANC)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GANC (untagged)-Human glucosidase, alpha, neutral C (GANC)
Vector | PCMV6-Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
(untagged)-Human mRNA for FLJ00088 protein
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GANC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GANC Antibody: synthetic peptide directed towards the middle region of human GANC. Synthetic peptide located within the following region: VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWEVR |
GANC (GFP-tagged) - Human glucosidase, alpha, neutral C (GANC), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GANC (GFP-tagged) - Human glucosidase, alpha, neutral C (GANC), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
GANC (untagged) - Human glucosidase, alpha, neutral C (GANC), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
GANC (untagged) - Human glucosidase, alpha, neutral C (GANC), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of GANC (NM_198141) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GANC (NM_001301410) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GANC (NM_001301409) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GANC (NM_198141) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GANC (NM_198141) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GANC (NM_001301410) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GANC (NM_001301409) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack