Products

cDNA Clones (29)
Proteins (14)
Antibodies (1)
Jump to Filters
View as table Download
OGDHL (NM_018245) Human Tagged ORF Clone
RC205225

USD 98.00

USD 800.00

In Stock

OGDHL (Myc-DDK-tagged)-Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
OGDHL (NM_018245) Human Tagged ORF Clone Lentiviral Particle
RC205225L1V

USD 1,310.00

3 Weeks

Lenti ORF particles, OGDHL (Myc-DDK tagged) - Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
OGDHL (NM_018245) Human Tagged ORF Clone Lentiviral Particle
RC205225L2V

USD 1,310.00

6 Weeks

Lenti ORF particles, OGDHL (mGFP-tagged) - Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
OGDHL (NM_001143997) Human Tagged ORF Clone Lentiviral Particle
RC226502L1V

USD 820.00

3 Weeks

Lenti ORF particles, OGDHL (Myc-DDK-tagged)-Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
OGDHL (NM_001143997) Human Tagged ORF Clone Lentiviral Particle
RC226502L2V

USD 820.00

6 Weeks

Lenti ORF particles, OGDHL (mGFP-tagged)-Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
OGDHL (NM_001143997) Human Tagged ORF Clone
RC226502

USD 420.00

In Stock

OGDHL (Myc-DDK-tagged)-Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
OGDHL (NM_018245) Human Tagged ORF Clone
RC205225L4

USD 1,110.00

In Stock

Lenti ORF clone of Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDHL (NM_018245) Human Tagged ORF Clone Lentiviral Particle
RC205225L3V

USD 1,310.00

5 Weeks

Lenti ORF particles, OGDHL (Myc-DDK tagged) - Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDHL (NM_018245) Human Tagged ORF Clone Lentiviral Particle
RC205225L4V

USD 1,310.00

3 Weeks

Lenti ORF particles, OGDHL (mGFP-tagged) - Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDHL (NM_001143997) Human Tagged ORF Clone
RC226502L3

USD 620.00

3 Weeks

Lenti-ORF clone of OGDHL (Myc-DDK-tagged)-Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDHL (NM_001143997) Human Tagged ORF Clone Lentiviral Particle
RC226502L3V

USD 820.00

11 Weeks

Lenti ORF particles, OGDHL (Myc-DDK-tagged)-Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDHL (NM_001143997) Human Tagged ORF Clone
RC226502L4

USD 620.00

3 Weeks

Lenti-ORF clone of OGDHL (mGFP-tagged)-Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDHL (NM_001143997) Human Tagged ORF Clone Lentiviral Particle
RC226502L4V

USD 820.00

11 Weeks

Lenti ORF particles, OGDHL (mGFP-tagged)-Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDHL (NM_001143996) Human Tagged ORF Clone
RC227996

USD 1,030.00

5 Weeks

OGDHL (Myc-DDK-tagged)-Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
OGDHL (NM_001143996) Human Tagged ORF Clone
RC227996L3

USD 1,230.00

5 Weeks

Lenti-ORF clone of OGDHL (Myc-DDK-tagged)-Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDHL (NM_001143996) Human Tagged ORF Clone Lentiviral Particle
RC227996L3V

USD 1,430.00

8 Weeks

Lenti ORF particles, OGDHL (Myc-DDK-tagged)-Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDHL (NM_001143996) Human Tagged ORF Clone
RC227996L4

USD 1,230.00

5 Weeks

Lenti-ORF clone of OGDHL (mGFP-tagged)-Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDHL (NM_001143996) Human Tagged ORF Clone Lentiviral Particle
RC227996L4V

USD 1,430.00

8 Weeks

Lenti ORF particles, OGDHL (mGFP-tagged)-Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDHL (NM_018245) Human Tagged ORF Clone
RG205225

USD 1,000.00

3 Weeks

OGDHL (GFP-tagged) - Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
OGDHL (NM_001143997) Human Tagged ORF Clone
RG226502

USD 460.00

3 Weeks

OGDHL (GFP-tagged) - Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
OGDHL (NM_001143996) Human Tagged ORF Clone
RG227996

USD 1,130.00

5 Weeks

OGDHL (GFP-tagged) - Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
OGDHL (NM_018245) Human Tagged ORF Clone
RC205225L1

USD 1,368.00

In Stock

Lenti ORF clone of Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
OGDHL (NM_001143997) Human Tagged Lenti ORF Clone
RC226502L1

USD 768.00

In Stock

Lenti-ORF clone of OGDHL (Myc-DDK-tagged)-Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
OGDHL (NM_018245) Human Tagged Lenti ORF Clone
RC205225L3

USD 1,368.00

3 Weeks

Lenti ORF clone of Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OGDHL Rabbit Polyclonal Antibody
TA344893

USD 475.00

5 Days

Rabbit Polyclonal Anti-OGDHL Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OGDHL antibody: synthetic peptide directed towards the N terminal of human OGDHL. Synthetic peptide located within the following region: VFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSWDSFFR
OGDHL (NM_018245) Human Tagged ORF Clone
RC205225L2

USD 1,110.00

3 Weeks

Lenti ORF clone of Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
OGDHL (NM_001143997) Human Tagged ORF Clone
RC226502L2

USD 620.00

3 Weeks

Lenti-ORF clone of OGDHL (mGFP-tagged)-Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
OGDHL (NM_001143997) Human Over-expression Lysate
LY428457

USD 605.00

In Stock

Transient overexpression lysate of oxoglutarate dehydrogenase-like (OGDHL), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
OGDHL (NM_018245) Human Over-expression Lysate
LY413186

USD 396.00

5 Days

Transient overexpression lysate of oxoglutarate dehydrogenase-like (OGDHL), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
OGDHL (NM_018245) Human Untagged Clone
SC304570

USD 1,100.00

2 Weeks

OGDHL (untagged)-Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
OGDHL (NM_018245) Human Over-expression Lysate
LC413186

USD 121.00

2 Weeks

OGDHL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
OGDHL (NM_001143997) Human Over-expression Lysate
LC428457

USD 187.00

2 Weeks

OGDHL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
OGDHL (NM_018245) Human Mass Spec Standard
PH305225

USD 2,055.00

3 Weeks

OGDHL MS Standard C13 and N15-labeled recombinant protein (NP_060715)

Tag C-Myc/DDK
Expression Host HEK293
OGDHL (NM_001143997) Human Untagged Clone
SC325335

USD 760.00

3 Weeks

OGDHL (untagged)-Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
OGDHL (NM_001143996) Human Untagged Clone
SC326298

USD 1,940.00

5 Weeks

OGDHL (untagged)-Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6 series
Tag Tag Free
OGDHL (NM_018245) ICC Control Block
TB405225

USD 1,450.00

4 Weeks

Transient overexpression of OGDHL (NM_018245) in HEK293T cells paraffin embedded controls for ICC/IHC staining

OGDHL (NM_001143997) ICC Control Block
TB426502

USD 1,070.00

4 Weeks

Transient overexpression of OGDHL (NM_001143997) in HEK293T cells paraffin embedded controls for ICC/IHC staining

OGDHL (NM_001143996) ICC Control Block
TB427996

USD 1,680.00

4 Weeks

Transient overexpression of OGDHL (NM_001143996) in HEK293T cells paraffin embedded controls for ICC/IHC staining

OGDHL Cytosection
TS405225

USD 225.00

4 Weeks

Transient overexpression of OGDHL (NM_018245) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

OGDHL Cytosection
TS405225P5

USD 889.00

4 Weeks

Transient overexpression of OGDHL (NM_018245) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

OGDHL Cytosection
TS426502

USD 225.00

4 Weeks

Transient overexpression of OGDHL (NM_001143997) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

OGDHL Cytosection
TS426502P5

USD 889.00

4 Weeks

Transient overexpression of OGDHL (NM_001143997) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

OGDHL ICC Control Sections
TS427996P5

USD 889.00

4 Weeks

Transient overexpression of OGDHL (NM_001143996) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack